From 79c5daeb85caaddc0afd99e85286453c75ee98b0 Mon Sep 17 00:00:00 2001 From: Tristan Swadell Date: Wed, 28 Aug 2024 15:51:27 -0700 Subject: [PATCH] CEL Spec and Proto Updates (#1011) * Migrate to the latest CEL Spec v0.16.1 * Update null assignability to match CEL-Spec --- WORKSPACE | 23 +- codelab/go.mod | 11 +- codelab/go.sum | 17 +- common/types/BUILD.bazel | 1 + common/types/null.go | 10 +- common/types/null_test.go | 15 + conformance/conformance_test.go | 7 +- conformance/go.mod | 16 +- conformance/go.sum | 26 +- go.mod | 10 +- go.sum | 17 +- policy/go.mod | 16 +- policy/go.sum | 44 +- repl/appengine/go.mod | 14 +- repl/appengine/go.sum | 21 +- repl/evaluator.go | 4 +- repl/go.mod | 16 +- repl/go.sum | 25 +- server/go.mod | 22 +- server/go.sum | 47 +- server/main/main.go | 3 +- server/server.go | 5 +- server/server_test.go | 3 +- .../x/text/feature/plural/tables.go | 2 +- .../text/internal/language/compact/tables.go | 356 +- .../x/text/internal/language/tables.go | 4686 +++++++++-------- .../x/text/internal/number/tables.go | 2 +- vendor/golang.org/x/text/language/match.go | 2 +- vendor/golang.org/x/text/language/tables.go | 138 +- .../golang.org/x/text/message/catalog/go19.go | 1 - .../x/text/message/catalog/gopre19.go | 1 - vendor/golang.org/x/text/message/message.go | 19 +- .../api/expr/v1alpha1/checked.pb.go | 4 +- .../googleapis/api/expr/v1alpha1/eval.pb.go | 4 +- .../api/expr/v1alpha1/explain.pb.go | 4 +- .../googleapis/api/expr/v1alpha1/syntax.pb.go | 592 ++- .../googleapis/api/expr/v1alpha1/value.pb.go | 4 +- .../googleapis/rpc/status/status.pb.go | 4 +- .../protobuf/encoding/protojson/decode.go | 4 +- .../protobuf/encoding/protojson/encode.go | 20 +- .../protobuf/encoding/prototext/decode.go | 4 +- .../protobuf/encoding/prototext/encode.go | 20 +- .../protobuf/internal/descfmt/stringer.go | 1 + .../editiondefaults/editions_defaults.binpb | Bin 63 -> 93 bytes .../internal/editionssupport/editions.go | 13 + .../protobuf/internal/encoding/json/decode.go | 2 +- .../protobuf/internal/encoding/tag/tag.go | 4 +- .../protobuf/internal/encoding/text/decode.go | 2 +- .../protobuf/internal/errors/errors.go | 21 +- .../protobuf/internal/filedesc/desc.go | 88 +- .../protobuf/internal/filedesc/desc_init.go | 43 +- .../protobuf/internal/filedesc/desc_lazy.go | 49 +- .../internal/filedesc/desc_list_gen.go | 11 + .../protobuf/internal/filedesc/editions.go | 22 +- .../protobuf/internal/filedesc/placeholder.go | 1 + .../protobuf/internal/filetype/build.go | 4 +- .../protobuf/internal/genid/descriptor_gen.go | 49 +- .../internal/genid/go_features_gen.go | 2 +- .../protobuf/internal/impl/api_export.go | 6 +- .../protobuf/internal/impl/checkinit.go | 2 +- .../protobuf/internal/impl/codec_extension.go | 22 + .../protobuf/internal/impl/codec_field.go | 64 +- .../protobuf/internal/impl/codec_map.go | 15 +- .../internal/impl/codec_messageset.go | 22 + .../protobuf/internal/impl/convert.go | 2 +- .../protobuf/internal/impl/convert_list.go | 2 +- .../protobuf/internal/impl/convert_map.go | 2 +- .../protobuf/internal/impl/encode.go | 48 +- .../protobuf/internal/impl/extension.go | 8 +- .../protobuf/internal/impl/legacy_enum.go | 3 +- .../internal/impl/legacy_extension.go | 2 +- .../protobuf/internal/impl/legacy_file.go | 4 +- .../protobuf/internal/impl/legacy_message.go | 14 +- .../protobuf/internal/impl/message.go | 8 +- .../protobuf/internal/impl/message_reflect.go | 45 +- .../internal/impl/message_reflect_gen.go | 146 +- .../protobuf/internal/impl/pointer_reflect.go | 6 +- .../protobuf/internal/impl/pointer_unsafe.go | 4 +- .../protobuf/internal/order/range.go | 4 +- .../protobuf/internal/version/version.go | 4 +- .../protobuf/proto/decode.go | 2 + .../protobuf/proto/encode.go | 44 +- .../protobuf/proto/extension.go | 17 +- .../protobuf/proto/messageset.go | 7 +- .../google.golang.org/protobuf/proto/size.go | 2 + .../protobuf/reflect/protodesc/desc.go | 13 +- .../protobuf/reflect/protodesc/desc_init.go | 49 +- .../reflect/protodesc/desc_resolve.go | 5 + .../reflect/protodesc/desc_validate.go | 73 +- .../protobuf/reflect/protodesc/editions.go | 11 +- .../protobuf/reflect/protodesc/proto.go | 22 + .../protobuf/reflect/protoreflect/proto.go | 2 +- .../reflect/protoreflect/source_gen.go | 21 + .../protobuf/reflect/protoreflect/type.go | 12 +- .../reflect/protoreflect/value_pure.go | 14 +- .../reflect/protoreflect/value_union.go | 14 +- .../protoreflect/value_unsafe_go120.go | 6 +- .../protoreflect/value_unsafe_go121.go | 8 +- .../reflect/protoregistry/registry.go | 14 +- .../types/descriptorpb/descriptor.pb.go | 1141 ++-- .../protobuf/types/dynamicpb/dynamic.go | 16 +- .../types/gofeaturespb/go_features.pb.go | 122 +- .../types/gofeaturespb/go_features.proto | 28 - .../protobuf/types/known/anypb/any.pb.go | 4 +- .../types/known/durationpb/duration.pb.go | 4 +- .../protobuf/types/known/emptypb/empty.pb.go | 4 +- .../types/known/structpb/struct.pb.go | 50 +- .../types/known/timestamppb/timestamp.pb.go | 4 +- .../types/known/wrapperspb/wrappers.pb.go | 20 +- vendor/modules.txt | 17 +- 110 files changed, 4805 insertions(+), 3926 deletions(-) create mode 100644 vendor/google.golang.org/protobuf/internal/editionssupport/editions.go delete mode 100644 vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto diff --git a/WORKSPACE b/WORKSPACE index 24f5e9e9..932a26ea 100644 --- a/WORKSPACE +++ b/WORKSPACE @@ -68,22 +68,22 @@ go_repository( tag = "v1.28.1", ) -# Generated Google APIs protos for Golang 08/03/2023 +# Generated Google APIs protos for Golang 08/24/2024 go_repository( name = "org_golang_google_genproto_googleapis_api", build_file_proto_mode = "disable_global", importpath = "google.golang.org/genproto/googleapis/api", - sum = "h1:nIgk/EEq3/YlnmVVXVnm14rC2oxgs1o0ong4sD/rd44=", - version = "v0.0.0-20230803162519-f966b187b2e5", + sum = "h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw=", + version = "v0.0.0-20240826202546-f6391c0de4c7", ) -# Generated Google APIs protos for Golang 08/03/2023 +# Generated Google APIs protos for Golang 08/24/2024 go_repository( name = "org_golang_google_genproto_googleapis_rpc", build_file_proto_mode = "disable_global", importpath = "google.golang.org/genproto/googleapis/rpc", - sum = "h1:eSaPbMR4T7WfH9FvABk36NBMacoTUKdWCvV0dx+KfOg=", - version = "v0.0.0-20230803162519-f966b187b2e5", + sum = "h1:Kqjm4WpoWvwhMPcrAczoTyMySQmYa9Wy2iL6Con4zn8=", + version = "v0.0.0-20240823204242-4ba0660f739c", ) # gRPC deps for v1.49.0 (including x/text and x/net) @@ -116,13 +116,18 @@ go_repository( version = "v4.13.0", ) -# CEL Spec deps +# CEL Spec deps (v0.16.1) go_repository( name = "com_google_cel_spec", - commit = "5299974f1c69103e4bb4eec48f7d9b24413ca3c7", - importpath = "github.com/google/cel-spec", + commit = "aa4eb92b7d469b32ff1a767ef4ef340b2d05a5d0", + importpath = "cel.dev/expr", ) +# local_repository( +# name = "com_google_cel_spec", +# path = "/github.com/google/cel-spec", +# ) + # strcase deps go_repository( name = "com_github_stoewer_go_strcase", diff --git a/codelab/go.mod b/codelab/go.mod index 36d9226f..9f0b67e5 100644 --- a/codelab/go.mod +++ b/codelab/go.mod @@ -1,20 +1,19 @@ module github.com/google/cel-go/codelab -go 1.18 +go 1.21 require ( github.com/golang/glog v1.0.0 - github.com/google/cel-go v0.13.0 - google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 - google.golang.org/protobuf v1.33.0 + github.com/google/cel-go v0.21.0 + google.golang.org/genproto/googleapis/rpc v0.0.0-20240823204242-4ba0660f739c + google.golang.org/protobuf v1.34.2 ) require ( github.com/antlr4-go/antlr/v4 v4.13.0 // indirect github.com/stoewer/go-strcase v1.2.0 // indirect golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc // indirect - golang.org/x/text v0.9.0 // indirect - google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 // indirect + google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 // indirect ) replace github.com/google/cel-go => ../. diff --git a/codelab/go.sum b/codelab/go.sum index a2f65031..ec05b857 100644 --- a/codelab/go.sum +++ b/codelab/go.sum @@ -5,6 +5,7 @@ github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSs github.com/golang/glog v1.0.0 h1:nfP3RFugxnNRyKgeWd4oI1nYvXpxrx8ck8ZrcizshdQ= github.com/golang/glog v1.0.0/go.mod h1:EWib/APOK0SL3dFbYqvxE3UYd8E6s1ouQ7iEp/0LWV4= github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= +github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/stoewer/go-strcase v1.2.0 h1:Z2iHWqGXH00XYgqDmNgQbIBxf3wrNq0F3feEy0ainaU= @@ -14,14 +15,14 @@ github.com/stretchr/testify v1.5.1 h1:nOGnQDM7FYENwehXlg/kFVnos3rEvtKTjRvOWSzb6H github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc h1:mCRnTeVUjcrhlRmO0VK8a6k6Rrf6TF9htwo2pJVSjIU= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc/go.mod h1:V1LtkGg67GoY2N1AnLN78QLrzxkLyJw7RJb1gzOOz9w= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= -golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 h1:nIgk/EEq3/YlnmVVXVnm14rC2oxgs1o0ong4sD/rd44= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5/go.mod h1:5DZzOUPCLYL3mNkQ0ms0F3EuUNZ7py1Bqeq6sxzI7/Q= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 h1:eSaPbMR4T7WfH9FvABk36NBMacoTUKdWCvV0dx+KfOg= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5/go.mod h1:zBEcrKX2ZOcEkHWxBPAIvYUWOKKMIhYcmNiUIu2ji3I= -google.golang.org/protobuf v1.33.0 h1:uNO2rsAINq/JlFpSdYEKIZ0uKD/R9cpdv0T+yoGwGmI= -google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= +golang.org/x/text v0.16.0 h1:a94ExnEXNtEwYLGJSIUxnWoxoRz/ZcCsV63ROupILh4= +golang.org/x/text v0.16.0/go.mod h1:GhwF1Be+LQoKShO3cGOHzqOgRrGaYc9AvblQOmPVHnI= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:OCdP9MfskevB/rbYvHTsXTtKC+3bHWajPdoKgjcYkfo= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240823204242-4ba0660f739c h1:Kqjm4WpoWvwhMPcrAczoTyMySQmYa9Wy2iL6Con4zn8= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240823204242-4ba0660f739c/go.mod h1:UqMtugtsSgubUsoxbuAoiCXvqvErP7Gf0so0mK9tHxU= +google.golang.org/protobuf v1.34.2 h1:6xV6lTsCfpGD21XK49h7MhtcApnLqkfYgPcdHftf6hg= +google.golang.org/protobuf v1.34.2/go.mod h1:qYOHts0dSfpeUzUFpOMr/WGzszTmLH+DiWniOlNbLDw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= diff --git a/common/types/BUILD.bazel b/common/types/BUILD.bazel index b5e44ffb..8c08190f 100644 --- a/common/types/BUILD.bazel +++ b/common/types/BUILD.bazel @@ -44,6 +44,7 @@ go_library( "@org_golang_google_protobuf//encoding/protojson:go_default_library", "@org_golang_google_protobuf//proto:go_default_library", "@org_golang_google_protobuf//reflect/protoreflect:go_default_library", + "@org_golang_google_protobuf//types/dynamicpb:go_default_library", "@org_golang_google_protobuf//types/known/anypb:go_default_library", "@org_golang_google_protobuf//types/known/durationpb:go_default_library", "@org_golang_google_protobuf//types/known/structpb:go_default_library", diff --git a/common/types/null.go b/common/types/null.go index 926ca3dc..8fb3c3c7 100644 --- a/common/types/null.go +++ b/common/types/null.go @@ -35,6 +35,8 @@ var ( // golang reflect type for Null values. nullReflectType = reflect.TypeOf(NullValue) + + protoIfaceType = reflect.TypeOf((*proto.Message)(nil)).Elem() ) // ConvertToNative implements ref.Val.ConvertToNative. @@ -61,8 +63,14 @@ func (n Null) ConvertToNative(typeDesc reflect.Type) (any, error) { return structpb.NewNullValue(), nil case boolWrapperType, byteWrapperType, doubleWrapperType, floatWrapperType, int32WrapperType, int64WrapperType, stringWrapperType, uint32WrapperType, - uint64WrapperType: + uint64WrapperType, durationValueType, timestampValueType, protoIfaceType: return nil, nil + case jsonListValueType, jsonStructType: + break + default: + if typeDesc.Implements(protoIfaceType) { + return nil, nil + } } case reflect.Interface: nv := n.Value() diff --git a/common/types/null_test.go b/common/types/null_test.go index 3ff92ba5..6f350a23 100644 --- a/common/types/null_test.go +++ b/common/types/null_test.go @@ -20,8 +20,10 @@ import ( "reflect" "testing" + "github.com/google/cel-go/test/proto3pb" "google.golang.org/protobuf/proto" + dynamicpb "google.golang.org/protobuf/types/dynamicpb" anypb "google.golang.org/protobuf/types/known/anypb" structpb "google.golang.org/protobuf/types/known/structpb" ) @@ -57,10 +59,23 @@ func TestNullConvertToNative(t *testing.T) { {goType: stringWrapperType}, {goType: uint32WrapperType}, {goType: uint64WrapperType}, + {goType: durationValueType}, + {goType: timestampValueType}, + {goType: reflect.TypeOf((*dynamicpb.Message)(nil))}, + {goType: reflect.TypeOf(&proto3pb.TestAllTypes{})}, + {goType: reflect.TypeOf((*proto3pb.TestAllTypes)(nil))}, { goType: reflect.TypeOf(1), err: errors.New("type conversion error from 'null_type' to 'int'"), }, + { + goType: jsonListValueType, + err: errors.New("type conversion error from 'null_type' to '*structpb.ListValue'"), + }, + { + goType: jsonStructType, + err: errors.New("type conversion error from 'null_type' to '*structpb.Struct'"), + }, } for i, tst := range tests { diff --git a/conformance/conformance_test.go b/conformance/conformance_test.go index 9ec36056..d784bc67 100644 --- a/conformance/conformance_test.go +++ b/conformance/conformance_test.go @@ -9,19 +9,20 @@ import ( "strings" "testing" + "cel.dev/expr/proto/test/v1/testpb" + "github.com/bazelbuild/rules_go/go/runfiles" "github.com/google/cel-go/cel" "github.com/google/cel-go/common" "github.com/google/cel-go/common/types" "github.com/google/cel-go/common/types/ref" "github.com/google/cel-go/ext" - "github.com/google/cel-spec/proto/test/v1/testpb" "github.com/google/go-cmp/cmp" "google.golang.org/protobuf/encoding/prototext" "google.golang.org/protobuf/testing/protocmp" - test2pb "github.com/google/cel-spec/proto/test/v1/proto2/test_all_types" - test3pb "github.com/google/cel-spec/proto/test/v1/proto3/test_all_types" + test2pb "cel.dev/expr/proto/test/v1/proto2/test_all_types" + test3pb "cel.dev/expr/proto/test/v1/proto3/test_all_types" exprpb "google.golang.org/genproto/googleapis/api/expr/v1alpha1" ) diff --git a/conformance/go.mod b/conformance/go.mod index da4fc485..494b0401 100644 --- a/conformance/go.mod +++ b/conformance/go.mod @@ -1,20 +1,22 @@ module github.com/google/cel-go/conformance -go 1.18 +go 1.21.1 require ( - github.com/bazelbuild/rules_go v0.38.1 + cel.dev/expr v0.16.1 + github.com/bazelbuild/rules_go v0.49.0 github.com/google/cel-go v0.21.0 - github.com/google/cel-spec v0.14.0 github.com/google/go-cmp v0.5.9 - google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 - google.golang.org/protobuf v1.33.0 + google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 + google.golang.org/protobuf v1.34.2 ) require ( github.com/antlr4-go/antlr/v4 v4.13.0 // indirect github.com/stoewer/go-strcase v1.2.0 // indirect golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc // indirect - golang.org/x/text v0.13.0 // indirect - google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 // indirect + golang.org/x/text v0.16.0 // indirect + google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 // indirect ) + +replace github.com/google/cel-go => ./.. diff --git a/conformance/go.sum b/conformance/go.sum index 65d05f75..6b135b4c 100644 --- a/conformance/go.sum +++ b/conformance/go.sum @@ -1,13 +1,11 @@ +cel.dev/expr v0.16.1 h1:NR0+oFYzR1CqLFhTAqg3ql59G9VfN8fKq1TCHJ6gq1g= +cel.dev/expr v0.16.1/go.mod h1:AsGA5zb3WruAEQeQng1RZdGEXmBj0jvMWh6l5SnNuC8= github.com/antlr4-go/antlr/v4 v4.13.0 h1:lxCg3LAv+EUK6t1i0y1V6/SLeUi0eKEKdhQAlS8TVTI= github.com/antlr4-go/antlr/v4 v4.13.0/go.mod h1:pfChB/xh/Unjila75QW7+VU4TSnWnnk9UTnmpPaOR2g= -github.com/bazelbuild/rules_go v0.38.1 h1:YGNsLhWe18Ielebav7cClP3GMwBxBE+xEArLHtmXDx8= -github.com/bazelbuild/rules_go v0.38.1/go.mod h1:TMHmtfpvyfsxaqfL9WnahCsXMWDMICTw7XeK9yVb+YU= +github.com/bazelbuild/rules_go v0.49.0 h1:5vCbuvy8Q11g41lseGJDc5vxhDjJtfxr6nM/IC4VmqM= +github.com/bazelbuild/rules_go v0.49.0/go.mod h1:Dhcz716Kqg1RHNWos+N6MlXNkjNP2EwZQ0LukRKJfMs= github.com/davecgh/go-spew v1.1.0 h1:ZDRjVQ15GmhC3fiQ8ni8+OwkZQO4DARzQgrnXU1Liz8= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/google/cel-go v0.21.0 h1:cl6uW/gxN+Hy50tNYvI691+sXxioCnstFzLp2WO4GCI= -github.com/google/cel-go v0.21.0/go.mod h1:rHUlWCcBKgyEk+eV03RPdZUekPp6YcJwV0FxuUksYxc= -github.com/google/cel-spec v0.14.0 h1:vVw8oKDC6TTksmM5qwOxx2r+PLDUDV16eqLzeMWVenk= -github.com/google/cel-spec v0.14.0/go.mod h1:sBeqYG7I0bX68Z49T0ydlXLxJK1+TBX8musTpcSjMcY= github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= @@ -19,14 +17,14 @@ github.com/stretchr/testify v1.5.1 h1:nOGnQDM7FYENwehXlg/kFVnos3rEvtKTjRvOWSzb6H github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc h1:mCRnTeVUjcrhlRmO0VK8a6k6Rrf6TF9htwo2pJVSjIU= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc/go.mod h1:V1LtkGg67GoY2N1AnLN78QLrzxkLyJw7RJb1gzOOz9w= -golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k= -golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 h1:nIgk/EEq3/YlnmVVXVnm14rC2oxgs1o0ong4sD/rd44= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5/go.mod h1:5DZzOUPCLYL3mNkQ0ms0F3EuUNZ7py1Bqeq6sxzI7/Q= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 h1:eSaPbMR4T7WfH9FvABk36NBMacoTUKdWCvV0dx+KfOg= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5/go.mod h1:zBEcrKX2ZOcEkHWxBPAIvYUWOKKMIhYcmNiUIu2ji3I= -google.golang.org/protobuf v1.33.0 h1:uNO2rsAINq/JlFpSdYEKIZ0uKD/R9cpdv0T+yoGwGmI= -google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= +golang.org/x/text v0.16.0 h1:a94ExnEXNtEwYLGJSIUxnWoxoRz/ZcCsV63ROupILh4= +golang.org/x/text v0.16.0/go.mod h1:GhwF1Be+LQoKShO3cGOHzqOgRrGaYc9AvblQOmPVHnI= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:OCdP9MfskevB/rbYvHTsXTtKC+3bHWajPdoKgjcYkfo= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 h1:2035KHhUv+EpyB+hWgJnaWKJOdX1E95w2S8Rr4uWKTs= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:UqMtugtsSgubUsoxbuAoiCXvqvErP7Gf0so0mK9tHxU= +google.golang.org/protobuf v1.34.2 h1:6xV6lTsCfpGD21XK49h7MhtcApnLqkfYgPcdHftf6hg= +google.golang.org/protobuf v1.34.2/go.mod h1:qYOHts0dSfpeUzUFpOMr/WGzszTmLH+DiWniOlNbLDw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= diff --git a/go.mod b/go.mod index c0de6399..7db16e86 100644 --- a/go.mod +++ b/go.mod @@ -1,16 +1,16 @@ module github.com/google/cel-go -go 1.18 +go 1.21 require ( github.com/antlr4-go/antlr/v4 v4.13.0 github.com/stoewer/go-strcase v1.2.0 - golang.org/x/text v0.9.0 - google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 - google.golang.org/protobuf v1.33.0 + golang.org/x/text v0.16.0 + google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 + google.golang.org/protobuf v1.34.2 ) require ( golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc // indirect - google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 // indirect + google.golang.org/genproto/googleapis/rpc v0.0.0-20240823204242-4ba0660f739c // indirect ) diff --git a/go.sum b/go.sum index a29e714b..98275de9 100644 --- a/go.sum +++ b/go.sum @@ -3,6 +3,7 @@ github.com/antlr4-go/antlr/v4 v4.13.0/go.mod h1:pfChB/xh/Unjila75QW7+VU4TSnWnnk9 github.com/davecgh/go-spew v1.1.0 h1:ZDRjVQ15GmhC3fiQ8ni8+OwkZQO4DARzQgrnXU1Liz8= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= +github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/stoewer/go-strcase v1.2.0 h1:Z2iHWqGXH00XYgqDmNgQbIBxf3wrNq0F3feEy0ainaU= @@ -12,14 +13,14 @@ github.com/stretchr/testify v1.5.1 h1:nOGnQDM7FYENwehXlg/kFVnos3rEvtKTjRvOWSzb6H github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc h1:mCRnTeVUjcrhlRmO0VK8a6k6Rrf6TF9htwo2pJVSjIU= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc/go.mod h1:V1LtkGg67GoY2N1AnLN78QLrzxkLyJw7RJb1gzOOz9w= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= -golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 h1:nIgk/EEq3/YlnmVVXVnm14rC2oxgs1o0ong4sD/rd44= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5/go.mod h1:5DZzOUPCLYL3mNkQ0ms0F3EuUNZ7py1Bqeq6sxzI7/Q= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 h1:eSaPbMR4T7WfH9FvABk36NBMacoTUKdWCvV0dx+KfOg= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5/go.mod h1:zBEcrKX2ZOcEkHWxBPAIvYUWOKKMIhYcmNiUIu2ji3I= -google.golang.org/protobuf v1.33.0 h1:uNO2rsAINq/JlFpSdYEKIZ0uKD/R9cpdv0T+yoGwGmI= -google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= +golang.org/x/text v0.16.0 h1:a94ExnEXNtEwYLGJSIUxnWoxoRz/ZcCsV63ROupILh4= +golang.org/x/text v0.16.0/go.mod h1:GhwF1Be+LQoKShO3cGOHzqOgRrGaYc9AvblQOmPVHnI= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:OCdP9MfskevB/rbYvHTsXTtKC+3bHWajPdoKgjcYkfo= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240823204242-4ba0660f739c h1:Kqjm4WpoWvwhMPcrAczoTyMySQmYa9Wy2iL6Con4zn8= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240823204242-4ba0660f739c/go.mod h1:UqMtugtsSgubUsoxbuAoiCXvqvErP7Gf0so0mK9tHxU= +google.golang.org/protobuf v1.34.2 h1:6xV6lTsCfpGD21XK49h7MhtcApnLqkfYgPcdHftf6hg= +google.golang.org/protobuf v1.34.2/go.mod h1:qYOHts0dSfpeUzUFpOMr/WGzszTmLH+DiWniOlNbLDw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= diff --git a/policy/go.mod b/policy/go.mod index e1f47612..6c516d39 100644 --- a/policy/go.mod +++ b/policy/go.mod @@ -3,18 +3,18 @@ module github.com/google/cel-go/policy go 1.20 require ( - github.com/google/cel-go v0.20.1 + github.com/google/cel-go v0.21.0 gopkg.in/yaml.v3 v3.0.1 ) require ( - github.com/antlr4-go/antlr/v4 v4.13.0 // indirect - github.com/stoewer/go-strcase v1.2.0 // indirect - golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc // indirect - golang.org/x/text v0.9.0 // indirect - google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 // indirect - google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 // indirect - google.golang.org/protobuf v1.33.0 // indirect + github.com/antlr4-go/antlr/v4 v4.13.1 // indirect + github.com/stoewer/go-strcase v1.3.0 // indirect + golang.org/x/exp v0.0.0-20240823005443-9b4947da3948 // indirect + golang.org/x/text v0.17.0 // indirect + google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 // indirect + google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 // indirect + google.golang.org/protobuf v1.34.2 // indirect ) replace github.com/google/cel-go => ../. diff --git a/policy/go.sum b/policy/go.sum index 1f23773b..cea4a19b 100644 --- a/policy/go.sum +++ b/policy/go.sum @@ -1,28 +1,32 @@ -github.com/antlr4-go/antlr/v4 v4.13.0 h1:lxCg3LAv+EUK6t1i0y1V6/SLeUi0eKEKdhQAlS8TVTI= -github.com/antlr4-go/antlr/v4 v4.13.0/go.mod h1:pfChB/xh/Unjila75QW7+VU4TSnWnnk9UTnmpPaOR2g= -github.com/davecgh/go-spew v1.1.0 h1:ZDRjVQ15GmhC3fiQ8ni8+OwkZQO4DARzQgrnXU1Liz8= +github.com/antlr4-go/antlr/v4 v4.13.1 h1:SqQKkuVZ+zWkMMNkjy5FZe5mr5WURWnlpmOuzYWrPrQ= +github.com/antlr4-go/antlr/v4 v4.13.1/go.mod h1:GKmUxMtwp6ZgGwZSva4eWPC5mS6vUAmOABFgjdkM7Nw= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= +github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= +github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= +github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= -github.com/stoewer/go-strcase v1.2.0 h1:Z2iHWqGXH00XYgqDmNgQbIBxf3wrNq0F3feEy0ainaU= -github.com/stoewer/go-strcase v1.2.0/go.mod h1:IBiWB2sKIp3wVVQ3Y035++gc+knqhUQag1KpM8ahLw8= +github.com/stoewer/go-strcase v1.3.0 h1:g0eASXYtp+yvN9fK8sH94oCIk0fau9uV1/ZdJ0AVEzs= +github.com/stoewer/go-strcase v1.3.0/go.mod h1:fAH5hQ5pehh+j3nZfvwdk2RgEgQjAoM8wodgtPmh1xo= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= -github.com/stretchr/testify v1.5.1 h1:nOGnQDM7FYENwehXlg/kFVnos3rEvtKTjRvOWSzb6H4= -github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA= -golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc h1:mCRnTeVUjcrhlRmO0VK8a6k6Rrf6TF9htwo2pJVSjIU= -golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc/go.mod h1:V1LtkGg67GoY2N1AnLN78QLrzxkLyJw7RJb1gzOOz9w= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= -golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 h1:nIgk/EEq3/YlnmVVXVnm14rC2oxgs1o0ong4sD/rd44= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5/go.mod h1:5DZzOUPCLYL3mNkQ0ms0F3EuUNZ7py1Bqeq6sxzI7/Q= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 h1:eSaPbMR4T7WfH9FvABk36NBMacoTUKdWCvV0dx+KfOg= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5/go.mod h1:zBEcrKX2ZOcEkHWxBPAIvYUWOKKMIhYcmNiUIu2ji3I= -google.golang.org/protobuf v1.33.0 h1:uNO2rsAINq/JlFpSdYEKIZ0uKD/R9cpdv0T+yoGwGmI= -google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= +github.com/stretchr/objx v0.4.0/go.mod h1:YvHI0jy2hoMjB+UWwv71VJQ9isScKT/TqJzVSSt89Yw= +github.com/stretchr/objx v0.5.0/go.mod h1:Yh+to48EsGEfYuaHDzXPcE3xhTkx73EhmCGUpEOglKo= +github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= +github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= +github.com/stretchr/testify v1.8.1 h1:w7B6lhMri9wdJUVmEZPGGhZzrYTPvgJArz7wNPgYKsk= +github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= +golang.org/x/exp v0.0.0-20240823005443-9b4947da3948 h1:kx6Ds3MlpiUHKj7syVnbp57++8WpuKPcR5yjLBjvLEA= +golang.org/x/exp v0.0.0-20240823005443-9b4947da3948/go.mod h1:akd2r19cwCdwSwWeIdzYQGa/EZZyqcOdwWiwj5L5eKQ= +golang.org/x/text v0.17.0 h1:XtiM5bkSOt+ewxlOE/aE/AKEHibwj/6gvWMl9Rsh0Qc= +golang.org/x/text v0.17.0/go.mod h1:BuEKDfySbSR4drPmRPG/7iBdf8hvFMuRexcpahXilzY= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:OCdP9MfskevB/rbYvHTsXTtKC+3bHWajPdoKgjcYkfo= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 h1:2035KHhUv+EpyB+hWgJnaWKJOdX1E95w2S8Rr4uWKTs= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:UqMtugtsSgubUsoxbuAoiCXvqvErP7Gf0so0mK9tHxU= +google.golang.org/protobuf v1.34.2 h1:6xV6lTsCfpGD21XK49h7MhtcApnLqkfYgPcdHftf6hg= +google.golang.org/protobuf v1.34.2/go.mod h1:qYOHts0dSfpeUzUFpOMr/WGzszTmLH+DiWniOlNbLDw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405 h1:yhCVgyC4o1eVCa2tZl7eS0r+SDo693bJlVdllGtEeKM= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= -gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw= -gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= +gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= diff --git a/repl/appengine/go.mod b/repl/appengine/go.mod index 88c1c03a..a130217b 100644 --- a/repl/appengine/go.mod +++ b/repl/appengine/go.mod @@ -1,19 +1,19 @@ module github.com/google/cel-go/repl/appengine -go 1.18 +go 1.21 require github.com/google/cel-go/repl v0.0.0-20230406155237-b081aea03865 require ( + cel.dev/expr v0.16.1 // indirect github.com/antlr4-go/antlr/v4 v4.13.0 // indirect - github.com/google/cel-go v0.18.1 // indirect - github.com/google/cel-spec v0.14.0 // indirect + github.com/google/cel-go v0.0.0-00010101000000-000000000000 // indirect github.com/stoewer/go-strcase v1.3.0 // indirect golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc // indirect - golang.org/x/text v0.13.0 // indirect - google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 // indirect - google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 // indirect - google.golang.org/protobuf v1.33.0 // indirect + golang.org/x/text v0.16.0 // indirect + google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 // indirect + google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 // indirect + google.golang.org/protobuf v1.34.2 // indirect ) replace github.com/google/cel-go => ../../. diff --git a/repl/appengine/go.sum b/repl/appengine/go.sum index 02b24e19..3db78f68 100644 --- a/repl/appengine/go.sum +++ b/repl/appengine/go.sum @@ -1,11 +1,12 @@ +cel.dev/expr v0.16.1 h1:NR0+oFYzR1CqLFhTAqg3ql59G9VfN8fKq1TCHJ6gq1g= +cel.dev/expr v0.16.1/go.mod h1:AsGA5zb3WruAEQeQng1RZdGEXmBj0jvMWh6l5SnNuC8= github.com/antlr4-go/antlr/v4 v4.13.0 h1:lxCg3LAv+EUK6t1i0y1V6/SLeUi0eKEKdhQAlS8TVTI= github.com/antlr4-go/antlr/v4 v4.13.0/go.mod h1:pfChB/xh/Unjila75QW7+VU4TSnWnnk9UTnmpPaOR2g= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/google/cel-spec v0.14.0 h1:vVw8oKDC6TTksmM5qwOxx2r+PLDUDV16eqLzeMWVenk= -github.com/google/cel-spec v0.14.0/go.mod h1:sBeqYG7I0bX68Z49T0ydlXLxJK1+TBX8musTpcSjMcY= github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= +github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/stoewer/go-strcase v1.3.0 h1:g0eASXYtp+yvN9fK8sH94oCIk0fau9uV1/ZdJ0AVEzs= @@ -19,14 +20,14 @@ github.com/stretchr/testify v1.8.1 h1:w7B6lhMri9wdJUVmEZPGGhZzrYTPvgJArz7wNPgYKs github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc h1:mCRnTeVUjcrhlRmO0VK8a6k6Rrf6TF9htwo2pJVSjIU= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc/go.mod h1:V1LtkGg67GoY2N1AnLN78QLrzxkLyJw7RJb1gzOOz9w= -golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k= -golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 h1:nIgk/EEq3/YlnmVVXVnm14rC2oxgs1o0ong4sD/rd44= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5/go.mod h1:5DZzOUPCLYL3mNkQ0ms0F3EuUNZ7py1Bqeq6sxzI7/Q= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 h1:eSaPbMR4T7WfH9FvABk36NBMacoTUKdWCvV0dx+KfOg= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5/go.mod h1:zBEcrKX2ZOcEkHWxBPAIvYUWOKKMIhYcmNiUIu2ji3I= -google.golang.org/protobuf v1.33.0 h1:uNO2rsAINq/JlFpSdYEKIZ0uKD/R9cpdv0T+yoGwGmI= -google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= +golang.org/x/text v0.16.0 h1:a94ExnEXNtEwYLGJSIUxnWoxoRz/ZcCsV63ROupILh4= +golang.org/x/text v0.16.0/go.mod h1:GhwF1Be+LQoKShO3cGOHzqOgRrGaYc9AvblQOmPVHnI= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:OCdP9MfskevB/rbYvHTsXTtKC+3bHWajPdoKgjcYkfo= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 h1:2035KHhUv+EpyB+hWgJnaWKJOdX1E95w2S8Rr4uWKTs= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:UqMtugtsSgubUsoxbuAoiCXvqvErP7Gf0so0mK9tHxU= +google.golang.org/protobuf v1.34.2 h1:6xV6lTsCfpGD21XK49h7MhtcApnLqkfYgPcdHftf6hg= +google.golang.org/protobuf v1.34.2/go.mod h1:qYOHts0dSfpeUzUFpOMr/WGzszTmLH+DiWniOlNbLDw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= diff --git a/repl/evaluator.go b/repl/evaluator.go index a5f8814e..d6c8d839 100644 --- a/repl/evaluator.go +++ b/repl/evaluator.go @@ -35,8 +35,8 @@ import ( "google.golang.org/protobuf/reflect/protodesc" "google.golang.org/protobuf/reflect/protoreflect" - test2pb "github.com/google/cel-spec/proto/test/v1/proto2/test_all_types" - test3pb "github.com/google/cel-spec/proto/test/v1/proto3/test_all_types" + test2pb "cel.dev/expr/proto/test/v1/proto2/test_all_types" + test3pb "cel.dev/expr/proto/test/v1/proto3/test_all_types" exprpb "google.golang.org/genproto/googleapis/api/expr/v1alpha1" attrpb "google.golang.org/genproto/googleapis/rpc/context/attribute_context" descpb "google.golang.org/protobuf/types/descriptorpb" diff --git a/repl/go.mod b/repl/go.mod index b62767d5..ed87152a 100644 --- a/repl/go.mod +++ b/repl/go.mod @@ -1,22 +1,22 @@ module github.com/google/cel-go/repl -go 1.18 +go 1.21 require ( + cel.dev/expr v0.16.1 github.com/antlr4-go/antlr/v4 v4.13.0 github.com/chzyer/readline v1.5.1 - github.com/google/cel-go v0.18.1 - github.com/google/cel-spec v0.14.0 - google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 - google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 - google.golang.org/protobuf v1.33.0 + github.com/google/cel-go v0.0.0-00010101000000-000000000000 + google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 + google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 + google.golang.org/protobuf v1.34.2 ) require ( github.com/stoewer/go-strcase v1.3.0 // indirect golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc // indirect - golang.org/x/sys v0.13.0 // indirect - golang.org/x/text v0.13.0 // indirect + golang.org/x/sys v0.21.0 // indirect + golang.org/x/text v0.16.0 // indirect ) replace github.com/google/cel-go => ../. diff --git a/repl/go.sum b/repl/go.sum index 880057f2..3d94449c 100644 --- a/repl/go.sum +++ b/repl/go.sum @@ -1,3 +1,5 @@ +cel.dev/expr v0.16.1 h1:NR0+oFYzR1CqLFhTAqg3ql59G9VfN8fKq1TCHJ6gq1g= +cel.dev/expr v0.16.1/go.mod h1:AsGA5zb3WruAEQeQng1RZdGEXmBj0jvMWh6l5SnNuC8= github.com/antlr4-go/antlr/v4 v4.13.0 h1:lxCg3LAv+EUK6t1i0y1V6/SLeUi0eKEKdhQAlS8TVTI= github.com/antlr4-go/antlr/v4 v4.13.0/go.mod h1:pfChB/xh/Unjila75QW7+VU4TSnWnnk9UTnmpPaOR2g= github.com/chzyer/logex v1.2.1 h1:XHDu3E6q+gdHgsdTPH6ImJMIp436vR6MPtH8gP05QzM= @@ -9,9 +11,8 @@ github.com/chzyer/test v1.0.0/go.mod h1:2JlltgoNkt4TW/z9V/IzDdFaMTM2JPIi26O1pF38 github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/google/cel-spec v0.14.0 h1:vVw8oKDC6TTksmM5qwOxx2r+PLDUDV16eqLzeMWVenk= -github.com/google/cel-spec v0.14.0/go.mod h1:sBeqYG7I0bX68Z49T0ydlXLxJK1+TBX8musTpcSjMcY= github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= +github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/stoewer/go-strcase v1.3.0 h1:g0eASXYtp+yvN9fK8sH94oCIk0fau9uV1/ZdJ0AVEzs= @@ -26,16 +27,16 @@ github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc h1:mCRnTeVUjcrhlRmO0VK8a6k6Rrf6TF9htwo2pJVSjIU= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc/go.mod h1:V1LtkGg67GoY2N1AnLN78QLrzxkLyJw7RJb1gzOOz9w= golang.org/x/sys v0.0.0-20220310020820-b874c991c1a5/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.13.0 h1:Af8nKPmuFypiUBjVoU9V20FiaFXOcuZI21p0ycVYYGE= -golang.org/x/sys v0.13.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/text v0.13.0 h1:ablQoSUd0tRdKxZewP80B+BaqeKJuVhuRxj/dkrun3k= -golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 h1:nIgk/EEq3/YlnmVVXVnm14rC2oxgs1o0ong4sD/rd44= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5/go.mod h1:5DZzOUPCLYL3mNkQ0ms0F3EuUNZ7py1Bqeq6sxzI7/Q= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 h1:eSaPbMR4T7WfH9FvABk36NBMacoTUKdWCvV0dx+KfOg= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5/go.mod h1:zBEcrKX2ZOcEkHWxBPAIvYUWOKKMIhYcmNiUIu2ji3I= -google.golang.org/protobuf v1.33.0 h1:uNO2rsAINq/JlFpSdYEKIZ0uKD/R9cpdv0T+yoGwGmI= -google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= +golang.org/x/sys v0.21.0 h1:rF+pYz3DAGSQAxAu1CbC7catZg4ebC4UIeIhKxBZvws= +golang.org/x/sys v0.21.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= +golang.org/x/text v0.16.0 h1:a94ExnEXNtEwYLGJSIUxnWoxoRz/ZcCsV63ROupILh4= +golang.org/x/text v0.16.0/go.mod h1:GhwF1Be+LQoKShO3cGOHzqOgRrGaYc9AvblQOmPVHnI= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:OCdP9MfskevB/rbYvHTsXTtKC+3bHWajPdoKgjcYkfo= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 h1:2035KHhUv+EpyB+hWgJnaWKJOdX1E95w2S8Rr4uWKTs= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:UqMtugtsSgubUsoxbuAoiCXvqvErP7Gf0so0mK9tHxU= +google.golang.org/protobuf v1.34.2 h1:6xV6lTsCfpGD21XK49h7MhtcApnLqkfYgPcdHftf6hg= +google.golang.org/protobuf v1.34.2/go.mod h1:qYOHts0dSfpeUzUFpOMr/WGzszTmLH+DiWniOlNbLDw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= diff --git a/server/go.mod b/server/go.mod index e8587b67..f760fdfc 100644 --- a/server/go.mod +++ b/server/go.mod @@ -1,25 +1,23 @@ module github.com/google/cel-go/server -go 1.18 +go 1.21 require ( - github.com/google/cel-go v0.13.0 - github.com/google/cel-spec v0.14.0 - google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 - google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 - google.golang.org/protobuf v1.33.0 + cel.dev/expr v0.16.1 + github.com/google/cel-go v0.0.0-00010101000000-000000000000 + google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 + google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 + google.golang.org/protobuf v1.34.2 ) require ( github.com/antlr4-go/antlr/v4 v4.13.0 // indirect - github.com/golang/protobuf v1.5.3 // indirect github.com/stoewer/go-strcase v1.2.0 // indirect golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc // indirect - golang.org/x/net v0.23.0 // indirect - golang.org/x/sys v0.18.0 // indirect - golang.org/x/text v0.14.0 // indirect - google.golang.org/genproto v0.0.0-20230726155614-23370e0ffb3e // indirect - google.golang.org/grpc v1.57.1 // indirect + golang.org/x/net v0.26.0 // indirect + golang.org/x/sys v0.21.0 // indirect + golang.org/x/text v0.16.0 // indirect + google.golang.org/grpc v1.65.0 // indirect ) replace github.com/google/cel-go => ./.. diff --git a/server/go.sum b/server/go.sum index bb753fc4..c86b1e4c 100644 --- a/server/go.sum +++ b/server/go.sum @@ -1,15 +1,13 @@ +cel.dev/expr v0.16.1 h1:NR0+oFYzR1CqLFhTAqg3ql59G9VfN8fKq1TCHJ6gq1g= +cel.dev/expr v0.16.1/go.mod h1:AsGA5zb3WruAEQeQng1RZdGEXmBj0jvMWh6l5SnNuC8= github.com/antlr4-go/antlr/v4 v4.13.0 h1:lxCg3LAv+EUK6t1i0y1V6/SLeUi0eKEKdhQAlS8TVTI= github.com/antlr4-go/antlr/v4 v4.13.0/go.mod h1:pfChB/xh/Unjila75QW7+VU4TSnWnnk9UTnmpPaOR2g= -github.com/bazelbuild/rules_go v0.38.1 h1:YGNsLhWe18Ielebav7cClP3GMwBxBE+xEArLHtmXDx8= +github.com/bazelbuild/rules_go v0.49.0 h1:5vCbuvy8Q11g41lseGJDc5vxhDjJtfxr6nM/IC4VmqM= +github.com/bazelbuild/rules_go v0.49.0/go.mod h1:Dhcz716Kqg1RHNWos+N6MlXNkjNP2EwZQ0LukRKJfMs= github.com/davecgh/go-spew v1.1.0 h1:ZDRjVQ15GmhC3fiQ8ni8+OwkZQO4DARzQgrnXU1Liz8= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/golang/protobuf v1.5.0/go.mod h1:FsONVRAS9T7sI+LIUmWTfcYkHO4aIWwzhcaSAoJOfIk= -github.com/golang/protobuf v1.5.3 h1:KhyjKVUg7Usr/dYsdSqoFveMYd5ko72D+zANwlG1mmg= -github.com/golang/protobuf v1.5.3/go.mod h1:XVQd3VNwM+JqD3oG2Ue2ip4fOMUkwXdXDdiuN0vRsmY= -github.com/google/cel-spec v0.14.0 h1:vVw8oKDC6TTksmM5qwOxx2r+PLDUDV16eqLzeMWVenk= -github.com/google/cel-spec v0.14.0/go.mod h1:sBeqYG7I0bX68Z49T0ydlXLxJK1+TBX8musTpcSjMcY= -github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= -github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= +github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI= +github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/stoewer/go-strcase v1.2.0 h1:Z2iHWqGXH00XYgqDmNgQbIBxf3wrNq0F3feEy0ainaU= @@ -19,25 +17,20 @@ github.com/stretchr/testify v1.5.1 h1:nOGnQDM7FYENwehXlg/kFVnos3rEvtKTjRvOWSzb6H github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc h1:mCRnTeVUjcrhlRmO0VK8a6k6Rrf6TF9htwo2pJVSjIU= golang.org/x/exp v0.0.0-20230515195305-f3d0a9c9a5cc/go.mod h1:V1LtkGg67GoY2N1AnLN78QLrzxkLyJw7RJb1gzOOz9w= -golang.org/x/net v0.23.0 h1:7EYJ93RZ9vYSZAIb2x3lnuvqO5zneoD6IvWjuhfxjTs= -golang.org/x/net v0.23.0/go.mod h1:JKghWKKOSdJwpW2GEx0Ja7fmaKnMsbu+MWVZTokSYmg= -golang.org/x/sys v0.18.0 h1:DBdB3niSjOA/O0blCZBqDefyWNYveAYMNF1Wum0DYQ4= -golang.org/x/sys v0.18.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= -golang.org/x/text v0.14.0 h1:ScX5w1eTa3QqT8oi6+ziP7dTV1S2+ALU0bI+0zXKWiQ= -golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= -golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= -google.golang.org/genproto v0.0.0-20230726155614-23370e0ffb3e h1:xIXmWJ303kJCuogpj0bHq+dcjcZHU+XFyc1I0Yl9cRg= -google.golang.org/genproto v0.0.0-20230726155614-23370e0ffb3e/go.mod h1:0ggbjUrZYpy1q+ANUS30SEoGZ53cdfwtbuG7Ptgy108= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 h1:nIgk/EEq3/YlnmVVXVnm14rC2oxgs1o0ong4sD/rd44= -google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5/go.mod h1:5DZzOUPCLYL3mNkQ0ms0F3EuUNZ7py1Bqeq6sxzI7/Q= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 h1:eSaPbMR4T7WfH9FvABk36NBMacoTUKdWCvV0dx+KfOg= -google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5/go.mod h1:zBEcrKX2ZOcEkHWxBPAIvYUWOKKMIhYcmNiUIu2ji3I= -google.golang.org/grpc v1.57.1 h1:upNTNqv0ES+2ZOOqACwVtS3Il8M12/+Hz41RCPzAjQg= -google.golang.org/grpc v1.57.1/go.mod h1:Sd+9RMTACXwmub0zcNY2c4arhtrbBYD1AUHI/dt16Mo= -google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw= -google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc= -google.golang.org/protobuf v1.33.0 h1:uNO2rsAINq/JlFpSdYEKIZ0uKD/R9cpdv0T+yoGwGmI= -google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= +golang.org/x/net v0.26.0 h1:soB7SVo0PWrY4vPW/+ay0jKDNScG2X9wFeYlXIvJsOQ= +golang.org/x/net v0.26.0/go.mod h1:5YKkiSynbBIh3p6iOc/vibscux0x38BZDkn8sCUPxHE= +golang.org/x/sys v0.21.0 h1:rF+pYz3DAGSQAxAu1CbC7catZg4ebC4UIeIhKxBZvws= +golang.org/x/sys v0.21.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= +golang.org/x/text v0.16.0 h1:a94ExnEXNtEwYLGJSIUxnWoxoRz/ZcCsV63ROupILh4= +golang.org/x/text v0.16.0/go.mod h1:GhwF1Be+LQoKShO3cGOHzqOgRrGaYc9AvblQOmPVHnI= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 h1:YcyjlL1PRr2Q17/I0dPk2JmYS5CDXfcdb2Z3YRioEbw= +google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:OCdP9MfskevB/rbYvHTsXTtKC+3bHWajPdoKgjcYkfo= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7 h1:2035KHhUv+EpyB+hWgJnaWKJOdX1E95w2S8Rr4uWKTs= +google.golang.org/genproto/googleapis/rpc v0.0.0-20240826202546-f6391c0de4c7/go.mod h1:UqMtugtsSgubUsoxbuAoiCXvqvErP7Gf0so0mK9tHxU= +google.golang.org/grpc v1.65.0 h1:bs/cUb4lp1G5iImFFd3u5ixQzweKizoZJAwBNLR42lc= +google.golang.org/grpc v1.65.0/go.mod h1:WgYC2ypjlB0EiQi6wdKixMqukr6lBc0Vo+oOgjrM5ZQ= +google.golang.org/protobuf v1.34.2 h1:6xV6lTsCfpGD21XK49h7MhtcApnLqkfYgPcdHftf6hg= +google.golang.org/protobuf v1.34.2/go.mod h1:qYOHts0dSfpeUzUFpOMr/WGzszTmLH+DiWniOlNbLDw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= diff --git a/server/main/main.go b/server/main/main.go index 48cec64c..6a2f4137 100644 --- a/server/main/main.go +++ b/server/main/main.go @@ -17,7 +17,8 @@ package main import ( "github.com/google/cel-go/server" - "github.com/google/cel-spec/tools/celrpc" + + "cel.dev/expr/tools/celrpc" ) func main() { diff --git a/server/server.go b/server/server.go index ed93adf0..355bbb4c 100644 --- a/server/server.go +++ b/server/server.go @@ -24,8 +24,9 @@ import ( "github.com/google/cel-go/common/types/ref" "github.com/google/cel-go/ext" - test2pb "github.com/google/cel-spec/proto/test/v1/proto2/test_all_types" - test3pb "github.com/google/cel-spec/proto/test/v1/proto3/test_all_types" + test2pb "cel.dev/expr/proto/test/v1/proto2/test_all_types" + test3pb "cel.dev/expr/proto/test/v1/proto3/test_all_types" + confpb "google.golang.org/genproto/googleapis/api/expr/conformance/v1alpha1" exprpb "google.golang.org/genproto/googleapis/api/expr/v1alpha1" codepb "google.golang.org/genproto/googleapis/rpc/code" diff --git a/server/server_test.go b/server/server_test.go index 7c133e96..1b34e3be 100644 --- a/server/server_test.go +++ b/server/server_test.go @@ -20,10 +20,11 @@ import ( "os" "testing" + "cel.dev/expr/tools/celrpc" + "github.com/google/cel-go/checker/decls" "github.com/google/cel-go/common/operators" "github.com/google/cel-go/test" - "github.com/google/cel-spec/tools/celrpc" confpb "google.golang.org/genproto/googleapis/api/expr/conformance/v1alpha1" exprpb "google.golang.org/genproto/googleapis/api/expr/v1alpha1" diff --git a/vendor/golang.org/x/text/feature/plural/tables.go b/vendor/golang.org/x/text/feature/plural/tables.go index 59ae9f24..b06b9cb4 100644 --- a/vendor/golang.org/x/text/feature/plural/tables.go +++ b/vendor/golang.org/x/text/feature/plural/tables.go @@ -549,4 +549,4 @@ var cardinalInclusionMasks = []uint64{ // 100 elements // Slots used for cardinal: A6 of 0xFF rules; 24 of 0xFF indexes; 37 of 64 sets -// Total table size 3860 bytes (3KiB); checksum: 4E56F7B1 +// Total table size 3860 bytes (3KiB); checksum: AAFBF21 diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de5..a09ed198 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b5837..14167e74 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/internal/number/tables.go b/vendor/golang.org/x/text/internal/number/tables.go index 0668a377..8efce81b 100644 --- a/vendor/golang.org/x/text/internal/number/tables.go +++ b/vendor/golang.org/x/text/internal/number/tables.go @@ -1216,4 +1216,4 @@ var formats = []Pattern{Pattern{RoundingContext: RoundingContext{MaxSignificantD 0x0}, Flags: 0x0}} -// Total table size 8634 bytes (8KiB); checksum: BE6D4A33 +// Total table size 8634 bytes (8KiB); checksum: 8F23386D diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index ee45f494..1153baf2 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. for i, lm := range language.AliasMap { - // If deprecated codes match and there is no fiddling with the script or + // If deprecated codes match and there is no fiddling with the script // or region, we consider it an exact match. conf := Exact if language.AliasTypes[i] != language.Macro { diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b6..a6573dcb 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/message/catalog/go19.go b/vendor/golang.org/x/text/message/catalog/go19.go index 4e5e87f8..291a4df9 100644 --- a/vendor/golang.org/x/text/message/catalog/go19.go +++ b/vendor/golang.org/x/text/message/catalog/go19.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build go1.9 -// +build go1.9 package catalog diff --git a/vendor/golang.org/x/text/message/catalog/gopre19.go b/vendor/golang.org/x/text/message/catalog/gopre19.go index 9e14685a..da44ebb8 100644 --- a/vendor/golang.org/x/text/message/catalog/gopre19.go +++ b/vendor/golang.org/x/text/message/catalog/gopre19.go @@ -3,7 +3,6 @@ // license that can be found in the LICENSE file. //go:build !go1.9 -// +build !go1.9 package catalog diff --git a/vendor/golang.org/x/text/message/message.go b/vendor/golang.org/x/text/message/message.go index 48d76630..91a97264 100644 --- a/vendor/golang.org/x/text/message/message.go +++ b/vendor/golang.org/x/text/message/message.go @@ -138,21 +138,20 @@ func (p *Printer) Printf(key Reference, a ...interface{}) (n int, err error) { func lookupAndFormat(p *printer, r Reference, a []interface{}) { p.fmt.Reset(a) - var id, msg string switch v := r.(type) { case string: - id, msg = v, v + if p.catContext.Execute(v) == catalog.ErrNotFound { + p.Render(v) + return + } case key: - id, msg = v.id, v.fallback - default: - panic("key argument is not a Reference") - } - - if p.catContext.Execute(id) == catalog.ErrNotFound { - if p.catContext.Execute(msg) == catalog.ErrNotFound { - p.Render(msg) + if p.catContext.Execute(v.id) == catalog.ErrNotFound && + p.catContext.Execute(v.fallback) == catalog.ErrNotFound { + p.Render(v.fallback) return } + default: + panic("key argument is not a Reference") } } diff --git a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/checked.pb.go b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/checked.pb.go index d687f68e..9f81dbcd 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/checked.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/checked.pb.go @@ -1,4 +1,4 @@ -// Copyright 2022 Google LLC +// Copyright 2024 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -15,7 +15,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.26.0 -// protoc v3.21.5 +// protoc v4.24.4 // source: google/api/expr/v1alpha1/checked.proto package expr diff --git a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/eval.pb.go b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/eval.pb.go index d38876ef..0a2ffb59 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/eval.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/eval.pb.go @@ -1,4 +1,4 @@ -// Copyright 2022 Google LLC +// Copyright 2024 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -15,7 +15,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.26.0 -// protoc v3.21.5 +// protoc v4.24.4 // source: google/api/expr/v1alpha1/eval.proto package expr diff --git a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/explain.pb.go b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/explain.pb.go index c980d6fc..57aaa2c9 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/explain.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/explain.pb.go @@ -1,4 +1,4 @@ -// Copyright 2022 Google LLC +// Copyright 2024 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -15,7 +15,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.26.0 -// protoc v3.21.5 +// protoc v4.24.4 // source: google/api/expr/v1alpha1/explain.proto package expr diff --git a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/syntax.pb.go b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/syntax.pb.go index 63c1ad93..c90c6015 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/syntax.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/syntax.pb.go @@ -1,4 +1,4 @@ -// Copyright 2022 Google LLC +// Copyright 2024 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -15,7 +15,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.26.0 -// protoc v3.21.9 +// protoc v4.24.4 // source: google/api/expr/v1alpha1/syntax.proto package expr @@ -38,6 +38,65 @@ const ( _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) ) +// CEL component specifier. +type SourceInfo_Extension_Component int32 + +const ( + // Unspecified, default. + SourceInfo_Extension_COMPONENT_UNSPECIFIED SourceInfo_Extension_Component = 0 + // Parser. Converts a CEL string to an AST. + SourceInfo_Extension_COMPONENT_PARSER SourceInfo_Extension_Component = 1 + // Type checker. Checks that references in an AST are defined and types + // agree. + SourceInfo_Extension_COMPONENT_TYPE_CHECKER SourceInfo_Extension_Component = 2 + // Runtime. Evaluates a parsed and optionally checked CEL AST against a + // context. + SourceInfo_Extension_COMPONENT_RUNTIME SourceInfo_Extension_Component = 3 +) + +// Enum value maps for SourceInfo_Extension_Component. +var ( + SourceInfo_Extension_Component_name = map[int32]string{ + 0: "COMPONENT_UNSPECIFIED", + 1: "COMPONENT_PARSER", + 2: "COMPONENT_TYPE_CHECKER", + 3: "COMPONENT_RUNTIME", + } + SourceInfo_Extension_Component_value = map[string]int32{ + "COMPONENT_UNSPECIFIED": 0, + "COMPONENT_PARSER": 1, + "COMPONENT_TYPE_CHECKER": 2, + "COMPONENT_RUNTIME": 3, + } +) + +func (x SourceInfo_Extension_Component) Enum() *SourceInfo_Extension_Component { + p := new(SourceInfo_Extension_Component) + *p = x + return p +} + +func (x SourceInfo_Extension_Component) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (SourceInfo_Extension_Component) Descriptor() protoreflect.EnumDescriptor { + return file_google_api_expr_v1alpha1_syntax_proto_enumTypes[0].Descriptor() +} + +func (SourceInfo_Extension_Component) Type() protoreflect.EnumType { + return &file_google_api_expr_v1alpha1_syntax_proto_enumTypes[0] +} + +func (x SourceInfo_Extension_Component) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Use SourceInfo_Extension_Component.Descriptor instead. +func (SourceInfo_Extension_Component) EnumDescriptor() ([]byte, []int) { + return file_google_api_expr_v1alpha1_syntax_proto_rawDescGZIP(), []int{3, 0, 0} +} + // An expression together with source information as returned by the parser. type ParsedExpr struct { state protoimpl.MessageState @@ -103,14 +162,16 @@ func (x *ParsedExpr) GetSourceInfo() *SourceInfo { // operators with the exception of the '.' operator are modelled as function // calls. This makes it easy to represent new operators into the existing AST. // -// All references within expressions must resolve to a [Decl][google.api.expr.v1alpha1.Decl] provided at -// type-check for an expression to be valid. A reference may either be a bare -// identifier `name` or a qualified identifier `google.api.name`. References -// may either refer to a value or a function declaration. +// All references within expressions must resolve to a +// [Decl][google.api.expr.v1alpha1.Decl] provided at type-check for an +// expression to be valid. A reference may either be a bare identifier `name` or +// a qualified identifier `google.api.name`. References may either refer to a +// value or a function declaration. // // For example, the expression `google.api.name.startsWith('expr')` references -// the declaration `google.api.name` within a [Expr.Select][google.api.expr.v1alpha1.Expr.Select] expression, and -// the function declaration `startsWith`. +// the declaration `google.api.name` within a +// [Expr.Select][google.api.expr.v1alpha1.Expr.Select] expression, and the +// function declaration `startsWith`. type Expr struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -291,7 +352,8 @@ func (*Expr_ComprehensionExpr) isExpr_ExprKind() {} // primitives. // // Lists and structs are not included as constants as these aggregate types may -// contain [Expr][google.api.expr.v1alpha1.Expr] elements which require evaluation and are thus not constant. +// contain [Expr][google.api.expr.v1alpha1.Expr] elements which require +// evaluation and are thus not constant. // // Examples of literals include: `"hello"`, `b'bytes'`, `1u`, `4.2`, `-2`, // `true`, `null`. @@ -528,6 +590,14 @@ type SourceInfo struct { // in the map corresponds to the expression id of the expanded macro, and the // value is the call `Expr` that was replaced. MacroCalls map[int64]*Expr `protobuf:"bytes,5,rep,name=macro_calls,json=macroCalls,proto3" json:"macro_calls,omitempty" protobuf_key:"varint,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` + // A list of tags for extensions that were used while parsing or type checking + // the source expression. For example, optimizations that require special + // runtime support may be specified. + // + // These are used to check feature support between components in separate + // implementations. This can be used to either skip redundant work or + // report an error if the extension is unsupported. + Extensions []*SourceInfo_Extension `protobuf:"bytes,6,rep,name=extensions,proto3" json:"extensions,omitempty"` } func (x *SourceInfo) Reset() { @@ -597,6 +667,13 @@ func (x *SourceInfo) GetMacroCalls() map[int64]*Expr { return nil } +func (x *SourceInfo) GetExtensions() []*SourceInfo_Extension { + if x != nil { + return x.Extensions + } + return nil +} + // A specific position in source. type SourcePosition struct { state protoimpl.MessageState @@ -684,7 +761,8 @@ type Expr_Ident struct { // Required. Holds a single, unqualified identifier, possibly preceded by a // '.'. // - // Qualified names are represented by the [Expr.Select][google.api.expr.v1alpha1.Expr.Select] expression. + // Qualified names are represented by the + // [Expr.Select][google.api.expr.v1alpha1.Expr.Select] expression. Name string `protobuf:"bytes,1,opt,name=name,proto3" json:"name,omitempty"` } @@ -1027,25 +1105,66 @@ func (x *Expr_CreateStruct) GetEntries() []*Expr_CreateStruct_Entry { // messages `has(m.x)` is defined as 'defined, but not set`. For proto3, the // macro tests whether the property is set to its default. For map and struct // types, the macro tests whether the property `x` is defined on `m`. +// +// Comprehensions for the standard environment macros evaluation can be best +// visualized as the following pseudocode: +// +// ``` +// let `accu_var` = `accu_init` +// +// for (let `iter_var` in `iter_range`) { +// if (!`loop_condition`) { +// break +// } +// `accu_var` = `loop_step` +// } +// +// return `result` +// ``` +// +// Comprehensions for the optional V2 macros which support map-to-map +// translation differ slightly from the standard environment macros in that +// they expose both the key or index in addition to the value for each list +// or map entry: +// +// ``` +// let `accu_var` = `accu_init` +// +// for (let `iter_var`, `iter_var2` in `iter_range`) { +// if (!`loop_condition`) { +// break +// } +// `accu_var` = `loop_step` +// } +// +// return `result` +// ``` type Expr_Comprehension struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - // The name of the iteration variable. + // The name of the first iteration variable. + // When the iter_range is a list, this variable is the list element. + // When the iter_range is a map, this variable is the map entry key. IterVar string `protobuf:"bytes,1,opt,name=iter_var,json=iterVar,proto3" json:"iter_var,omitempty"` - // The range over which var iterates. + // The name of the second iteration variable, empty if not set. + // When the iter_range is a list, this variable is the integer index. + // When the iter_range is a map, this variable is the map entry value. + // This field is only set for comprehension v2 macros. + IterVar2 string `protobuf:"bytes,8,opt,name=iter_var2,json=iterVar2,proto3" json:"iter_var2,omitempty"` + // The range over which the comprehension iterates. IterRange *Expr `protobuf:"bytes,2,opt,name=iter_range,json=iterRange,proto3" json:"iter_range,omitempty"` // The name of the variable used for accumulation of the result. AccuVar string `protobuf:"bytes,3,opt,name=accu_var,json=accuVar,proto3" json:"accu_var,omitempty"` // The initial value of the accumulator. AccuInit *Expr `protobuf:"bytes,4,opt,name=accu_init,json=accuInit,proto3" json:"accu_init,omitempty"` - // An expression which can contain iter_var and accu_var. + // An expression which can contain iter_var, iter_var2, and accu_var. // // Returns false when the result has been computed and may be used as // a hint to short-circuit the remainder of the comprehension. LoopCondition *Expr `protobuf:"bytes,5,opt,name=loop_condition,json=loopCondition,proto3" json:"loop_condition,omitempty"` - // An expression which can contain iter_var and accu_var. + // An expression which can contain iter_var, iter_var2, and accu_var. // // Computes the next value of accu_var. LoopStep *Expr `protobuf:"bytes,6,opt,name=loop_step,json=loopStep,proto3" json:"loop_step,omitempty"` @@ -1094,6 +1213,13 @@ func (x *Expr_Comprehension) GetIterVar() string { return "" } +func (x *Expr_Comprehension) GetIterVar2() string { + if x != nil { + return x.IterVar2 + } + return "" +} + func (x *Expr_Comprehension) GetIterRange() *Expr { if x != nil { return x.IterRange @@ -1255,6 +1381,137 @@ func (*Expr_CreateStruct_Entry_FieldKey) isExpr_CreateStruct_Entry_KeyKind() {} func (*Expr_CreateStruct_Entry_MapKey) isExpr_CreateStruct_Entry_KeyKind() {} +// An extension that was requested for the source expression. +type SourceInfo_Extension struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Identifier for the extension. Example: constant_folding + Id string `protobuf:"bytes,1,opt,name=id,proto3" json:"id,omitempty"` + // If set, the listed components must understand the extension for the + // expression to evaluate correctly. + // + // This field has set semantics, repeated values should be deduplicated. + AffectedComponents []SourceInfo_Extension_Component `protobuf:"varint,2,rep,packed,name=affected_components,json=affectedComponents,proto3,enum=google.api.expr.v1alpha1.SourceInfo_Extension_Component" json:"affected_components,omitempty"` + // Version info. May be skipped if it isn't meaningful for the extension. + // (for example constant_folding might always be v0.0). + Version *SourceInfo_Extension_Version `protobuf:"bytes,3,opt,name=version,proto3" json:"version,omitempty"` +} + +func (x *SourceInfo_Extension) Reset() { + *x = SourceInfo_Extension{} + if protoimpl.UnsafeEnabled { + mi := &file_google_api_expr_v1alpha1_syntax_proto_msgTypes[12] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *SourceInfo_Extension) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*SourceInfo_Extension) ProtoMessage() {} + +func (x *SourceInfo_Extension) ProtoReflect() protoreflect.Message { + mi := &file_google_api_expr_v1alpha1_syntax_proto_msgTypes[12] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use SourceInfo_Extension.ProtoReflect.Descriptor instead. +func (*SourceInfo_Extension) Descriptor() ([]byte, []int) { + return file_google_api_expr_v1alpha1_syntax_proto_rawDescGZIP(), []int{3, 0} +} + +func (x *SourceInfo_Extension) GetId() string { + if x != nil { + return x.Id + } + return "" +} + +func (x *SourceInfo_Extension) GetAffectedComponents() []SourceInfo_Extension_Component { + if x != nil { + return x.AffectedComponents + } + return nil +} + +func (x *SourceInfo_Extension) GetVersion() *SourceInfo_Extension_Version { + if x != nil { + return x.Version + } + return nil +} + +// Version +type SourceInfo_Extension_Version struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // Major version changes indicate different required support level from + // the required components. + Major int64 `protobuf:"varint,1,opt,name=major,proto3" json:"major,omitempty"` + // Minor version changes must not change the observed behavior from + // existing implementations, but may be provided informationally. + Minor int64 `protobuf:"varint,2,opt,name=minor,proto3" json:"minor,omitempty"` +} + +func (x *SourceInfo_Extension_Version) Reset() { + *x = SourceInfo_Extension_Version{} + if protoimpl.UnsafeEnabled { + mi := &file_google_api_expr_v1alpha1_syntax_proto_msgTypes[15] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *SourceInfo_Extension_Version) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*SourceInfo_Extension_Version) ProtoMessage() {} + +func (x *SourceInfo_Extension_Version) ProtoReflect() protoreflect.Message { + mi := &file_google_api_expr_v1alpha1_syntax_proto_msgTypes[15] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use SourceInfo_Extension_Version.ProtoReflect.Descriptor instead. +func (*SourceInfo_Extension_Version) Descriptor() ([]byte, []int) { + return file_google_api_expr_v1alpha1_syntax_proto_rawDescGZIP(), []int{3, 0, 0} +} + +func (x *SourceInfo_Extension_Version) GetMajor() int64 { + if x != nil { + return x.Major + } + return 0 +} + +func (x *SourceInfo_Extension_Version) GetMinor() int64 { + if x != nil { + return x.Minor + } + return 0 +} + var File_google_api_expr_v1alpha1_syntax_proto protoreflect.FileDescriptor var file_google_api_expr_v1alpha1_syntax_proto_rawDesc = []byte{ @@ -1276,7 +1533,7 @@ var file_google_api_expr_v1alpha1_syntax_proto_rawDesc = []byte{ 0x66, 0x6f, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x52, 0x0a, - 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x22, 0xae, 0x0d, 0x0a, 0x04, 0x45, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x22, 0xcb, 0x0d, 0x0a, 0x04, 0x45, 0x78, 0x70, 0x72, 0x12, 0x0e, 0x0a, 0x02, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, 0x02, 0x69, 0x64, 0x12, 0x43, 0x0a, 0x0a, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x5f, 0x65, 0x78, 0x70, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, @@ -1358,78 +1615,109 @@ var file_google_api_expr_v1alpha1_syntax_proto_rawDesc = []byte{ 0x45, 0x78, 0x70, 0x72, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x5f, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0d, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x42, 0x0a, 0x0a, 0x08, 0x6b, 0x65, 0x79, 0x5f, 0x6b, 0x69, 0x6e, 0x64, 0x1a, 0xfd, - 0x02, 0x0a, 0x0d, 0x43, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x68, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, + 0x72, 0x79, 0x42, 0x0a, 0x0a, 0x08, 0x6b, 0x65, 0x79, 0x5f, 0x6b, 0x69, 0x6e, 0x64, 0x1a, 0x9a, + 0x03, 0x0a, 0x0d, 0x43, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x68, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x19, 0x0a, 0x08, 0x69, 0x74, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x72, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x07, 0x69, 0x74, 0x65, 0x72, 0x56, 0x61, 0x72, 0x12, 0x3d, 0x0a, 0x0a, 0x69, - 0x74, 0x65, 0x72, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, - 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, 0x2e, 0x45, 0x78, 0x70, 0x72, 0x52, - 0x09, 0x69, 0x74, 0x65, 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x19, 0x0a, 0x08, 0x61, 0x63, - 0x63, 0x75, 0x5f, 0x76, 0x61, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x61, 0x63, - 0x63, 0x75, 0x56, 0x61, 0x72, 0x12, 0x3b, 0x0a, 0x09, 0x61, 0x63, 0x63, 0x75, 0x5f, 0x69, 0x6e, - 0x69, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, - 0x68, 0x61, 0x31, 0x2e, 0x45, 0x78, 0x70, 0x72, 0x52, 0x08, 0x61, 0x63, 0x63, 0x75, 0x49, 0x6e, - 0x69, 0x74, 0x12, 0x45, 0x0a, 0x0e, 0x6c, 0x6f, 0x6f, 0x70, 0x5f, 0x63, 0x6f, 0x6e, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, - 0x6c, 0x70, 0x68, 0x61, 0x31, 0x2e, 0x45, 0x78, 0x70, 0x72, 0x52, 0x0d, 0x6c, 0x6f, 0x6f, 0x70, - 0x43, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3b, 0x0a, 0x09, 0x6c, 0x6f, 0x6f, - 0x70, 0x5f, 0x73, 0x74, 0x65, 0x70, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, + 0x28, 0x09, 0x52, 0x07, 0x69, 0x74, 0x65, 0x72, 0x56, 0x61, 0x72, 0x12, 0x1b, 0x0a, 0x09, 0x69, + 0x74, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x72, 0x32, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, + 0x69, 0x74, 0x65, 0x72, 0x56, 0x61, 0x72, 0x32, 0x12, 0x3d, 0x0a, 0x0a, 0x69, 0x74, 0x65, 0x72, + 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, - 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, 0x2e, 0x45, 0x78, 0x70, 0x72, 0x52, 0x08, 0x6c, 0x6f, - 0x6f, 0x70, 0x53, 0x74, 0x65, 0x70, 0x12, 0x36, 0x0a, 0x06, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, - 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, - 0x31, 0x2e, 0x45, 0x78, 0x70, 0x72, 0x52, 0x06, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x42, 0x0b, - 0x0a, 0x09, 0x65, 0x78, 0x70, 0x72, 0x5f, 0x6b, 0x69, 0x6e, 0x64, 0x22, 0xc1, 0x03, 0x0a, 0x08, - 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x12, 0x3b, 0x0a, 0x0a, 0x6e, 0x75, 0x6c, 0x6c, - 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x1a, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4e, - 0x75, 0x6c, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x48, 0x00, 0x52, 0x09, 0x6e, 0x75, 0x6c, 0x6c, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0a, 0x62, 0x6f, 0x6f, 0x6c, 0x5f, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x09, 0x62, 0x6f, 0x6f, - 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0b, 0x69, 0x6e, 0x74, 0x36, 0x34, 0x5f, - 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x0a, 0x69, - 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x75, 0x69, 0x6e, - 0x74, 0x36, 0x34, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x04, 0x48, - 0x00, 0x52, 0x0b, 0x75, 0x69, 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, - 0x0a, 0x0c, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, - 0x20, 0x01, 0x28, 0x01, 0x48, 0x00, 0x52, 0x0b, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x72, - 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0b, 0x62, 0x79, 0x74, 0x65, - 0x73, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0c, 0x48, 0x00, 0x52, - 0x0a, 0x62, 0x79, 0x74, 0x65, 0x73, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x46, 0x0a, 0x0e, 0x64, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x08, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x02, - 0x18, 0x01, 0x48, 0x00, 0x52, 0x0d, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x12, 0x49, 0x0a, 0x0f, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, - 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, - 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x02, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0e, - 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0f, - 0x0a, 0x0d, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x5f, 0x6b, 0x69, 0x6e, 0x64, 0x22, - 0xb9, 0x03, 0x0a, 0x0a, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x25, - 0x0a, 0x0e, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x56, 0x65, - 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x1a, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x12, 0x21, 0x0a, 0x0c, 0x6c, 0x69, 0x6e, 0x65, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, - 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x05, 0x52, 0x0b, 0x6c, 0x69, 0x6e, 0x65, 0x4f, 0x66, 0x66, - 0x73, 0x65, 0x74, 0x73, 0x12, 0x51, 0x0a, 0x09, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, 0x2e, 0x45, 0x78, 0x70, 0x72, 0x52, 0x09, 0x69, 0x74, + 0x65, 0x72, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x19, 0x0a, 0x08, 0x61, 0x63, 0x63, 0x75, 0x5f, + 0x76, 0x61, 0x72, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x61, 0x63, 0x63, 0x75, 0x56, + 0x61, 0x72, 0x12, 0x3b, 0x0a, 0x09, 0x61, 0x63, 0x63, 0x75, 0x5f, 0x69, 0x6e, 0x69, 0x74, 0x18, + 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, + 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, + 0x2e, 0x45, 0x78, 0x70, 0x72, 0x52, 0x08, 0x61, 0x63, 0x63, 0x75, 0x49, 0x6e, 0x69, 0x74, 0x12, + 0x45, 0x0a, 0x0e, 0x6c, 0x6f, 0x6f, 0x70, 0x5f, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, + 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, - 0x61, 0x31, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x50, 0x6f, - 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x09, 0x70, 0x6f, - 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x55, 0x0a, 0x0b, 0x6d, 0x61, 0x63, 0x72, 0x6f, - 0x5f, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, - 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, - 0x66, 0x6f, 0x2e, 0x4d, 0x61, 0x63, 0x72, 0x6f, 0x43, 0x61, 0x6c, 0x6c, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x52, 0x0a, 0x6d, 0x61, 0x63, 0x72, 0x6f, 0x43, 0x61, 0x6c, 0x6c, 0x73, 0x1a, 0x3c, + 0x61, 0x31, 0x2e, 0x45, 0x78, 0x70, 0x72, 0x52, 0x0d, 0x6c, 0x6f, 0x6f, 0x70, 0x43, 0x6f, 0x6e, + 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x3b, 0x0a, 0x09, 0x6c, 0x6f, 0x6f, 0x70, 0x5f, 0x73, + 0x74, 0x65, 0x70, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, + 0x70, 0x68, 0x61, 0x31, 0x2e, 0x45, 0x78, 0x70, 0x72, 0x52, 0x08, 0x6c, 0x6f, 0x6f, 0x70, 0x53, + 0x74, 0x65, 0x70, 0x12, 0x36, 0x0a, 0x06, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x18, 0x07, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, 0x2e, 0x45, + 0x78, 0x70, 0x72, 0x52, 0x06, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x42, 0x0b, 0x0a, 0x09, 0x65, + 0x78, 0x70, 0x72, 0x5f, 0x6b, 0x69, 0x6e, 0x64, 0x22, 0xc1, 0x03, 0x0a, 0x08, 0x43, 0x6f, 0x6e, + 0x73, 0x74, 0x61, 0x6e, 0x74, 0x12, 0x3b, 0x0a, 0x0a, 0x6e, 0x75, 0x6c, 0x6c, 0x5f, 0x76, 0x61, + 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4e, 0x75, 0x6c, 0x6c, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x48, 0x00, 0x52, 0x09, 0x6e, 0x75, 0x6c, 0x6c, 0x56, 0x61, 0x6c, + 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0a, 0x62, 0x6f, 0x6f, 0x6c, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x48, 0x00, 0x52, 0x09, 0x62, 0x6f, 0x6f, 0x6c, 0x56, 0x61, + 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0b, 0x69, 0x6e, 0x74, 0x36, 0x34, 0x5f, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x0a, 0x69, 0x6e, 0x74, 0x36, + 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x75, 0x69, 0x6e, 0x74, 0x36, 0x34, + 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x04, 0x48, 0x00, 0x52, 0x0b, + 0x75, 0x69, 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x64, + 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, + 0x01, 0x48, 0x00, 0x52, 0x0b, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x12, 0x23, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, + 0x18, 0x06, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, + 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0b, 0x62, 0x79, 0x74, 0x65, 0x73, 0x5f, 0x76, + 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0c, 0x48, 0x00, 0x52, 0x0a, 0x62, 0x79, + 0x74, 0x65, 0x73, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x46, 0x0a, 0x0e, 0x64, 0x75, 0x72, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x02, 0x18, 0x01, 0x48, + 0x00, 0x52, 0x0d, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x12, 0x49, 0x0a, 0x0f, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x5f, 0x76, 0x61, + 0x6c, 0x75, 0x65, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, + 0x73, 0x74, 0x61, 0x6d, 0x70, 0x42, 0x02, 0x18, 0x01, 0x48, 0x00, 0x52, 0x0e, 0x74, 0x69, 0x6d, + 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x0f, 0x0a, 0x0d, 0x63, + 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x5f, 0x6b, 0x69, 0x6e, 0x64, 0x22, 0x8c, 0x07, 0x0a, + 0x0a, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x25, 0x0a, 0x0e, 0x73, + 0x79, 0x6e, 0x74, 0x61, 0x78, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x09, 0x52, 0x0d, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x56, 0x65, 0x72, 0x73, 0x69, + 0x6f, 0x6e, 0x12, 0x1a, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x21, + 0x0a, 0x0c, 0x6c, 0x69, 0x6e, 0x65, 0x5f, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x73, 0x18, 0x03, + 0x20, 0x03, 0x28, 0x05, 0x52, 0x0b, 0x6c, 0x69, 0x6e, 0x65, 0x4f, 0x66, 0x66, 0x73, 0x65, 0x74, + 0x73, 0x12, 0x51, 0x0a, 0x09, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x04, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x33, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, + 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, 0x2e, + 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x50, 0x6f, 0x73, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x09, 0x70, 0x6f, 0x73, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x55, 0x0a, 0x0b, 0x6d, 0x61, 0x63, 0x72, 0x6f, 0x5f, 0x63, 0x61, + 0x6c, 0x6c, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x34, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, + 0x70, 0x68, 0x61, 0x31, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, + 0x4d, 0x61, 0x63, 0x72, 0x6f, 0x43, 0x61, 0x6c, 0x6c, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, + 0x0a, 0x6d, 0x61, 0x63, 0x72, 0x6f, 0x43, 0x61, 0x6c, 0x6c, 0x73, 0x12, 0x4e, 0x0a, 0x0a, 0x65, + 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, + 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, + 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, + 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, + 0x0a, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0x80, 0x03, 0x0a, 0x09, + 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x0e, 0x0a, 0x02, 0x69, 0x64, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x02, 0x69, 0x64, 0x12, 0x69, 0x0a, 0x13, 0x61, 0x66, 0x66, + 0x65, 0x63, 0x74, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x73, + 0x18, 0x02, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x38, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x61, 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, + 0x31, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x45, 0x78, 0x74, + 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x2e, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, + 0x52, 0x12, 0x61, 0x66, 0x66, 0x65, 0x63, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, + 0x65, 0x6e, 0x74, 0x73, 0x12, 0x50, 0x0a, 0x07, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, + 0x70, 0x69, 0x2e, 0x65, 0x78, 0x70, 0x72, 0x2e, 0x76, 0x31, 0x61, 0x6c, 0x70, 0x68, 0x61, 0x31, + 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x45, 0x78, 0x74, 0x65, + 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x2e, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x76, + 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x1a, 0x35, 0x0a, 0x07, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, + 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, + 0x52, 0x05, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x12, 0x14, 0x0a, 0x05, 0x6d, 0x69, 0x6e, 0x6f, 0x72, + 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, 0x05, 0x6d, 0x69, 0x6e, 0x6f, 0x72, 0x22, 0x6f, 0x0a, + 0x09, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x12, 0x19, 0x0a, 0x15, 0x43, 0x4f, + 0x4d, 0x50, 0x4f, 0x4e, 0x45, 0x4e, 0x54, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, + 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, 0x43, 0x4f, 0x4d, 0x50, 0x4f, 0x4e, 0x45, + 0x4e, 0x54, 0x5f, 0x50, 0x41, 0x52, 0x53, 0x45, 0x52, 0x10, 0x01, 0x12, 0x1a, 0x0a, 0x16, 0x43, + 0x4f, 0x4d, 0x50, 0x4f, 0x4e, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x43, 0x48, + 0x45, 0x43, 0x4b, 0x45, 0x52, 0x10, 0x02, 0x12, 0x15, 0x0a, 0x11, 0x43, 0x4f, 0x4d, 0x50, 0x4f, + 0x4e, 0x45, 0x4e, 0x54, 0x5f, 0x52, 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x03, 0x1a, 0x3c, 0x0a, 0x0e, 0x50, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, @@ -1469,59 +1757,66 @@ func file_google_api_expr_v1alpha1_syntax_proto_rawDescGZIP() []byte { return file_google_api_expr_v1alpha1_syntax_proto_rawDescData } -var file_google_api_expr_v1alpha1_syntax_proto_msgTypes = make([]protoimpl.MessageInfo, 14) +var file_google_api_expr_v1alpha1_syntax_proto_enumTypes = make([]protoimpl.EnumInfo, 1) +var file_google_api_expr_v1alpha1_syntax_proto_msgTypes = make([]protoimpl.MessageInfo, 16) var file_google_api_expr_v1alpha1_syntax_proto_goTypes = []interface{}{ - (*ParsedExpr)(nil), // 0: google.api.expr.v1alpha1.ParsedExpr - (*Expr)(nil), // 1: google.api.expr.v1alpha1.Expr - (*Constant)(nil), // 2: google.api.expr.v1alpha1.Constant - (*SourceInfo)(nil), // 3: google.api.expr.v1alpha1.SourceInfo - (*SourcePosition)(nil), // 4: google.api.expr.v1alpha1.SourcePosition - (*Expr_Ident)(nil), // 5: google.api.expr.v1alpha1.Expr.Ident - (*Expr_Select)(nil), // 6: google.api.expr.v1alpha1.Expr.Select - (*Expr_Call)(nil), // 7: google.api.expr.v1alpha1.Expr.Call - (*Expr_CreateList)(nil), // 8: google.api.expr.v1alpha1.Expr.CreateList - (*Expr_CreateStruct)(nil), // 9: google.api.expr.v1alpha1.Expr.CreateStruct - (*Expr_Comprehension)(nil), // 10: google.api.expr.v1alpha1.Expr.Comprehension - (*Expr_CreateStruct_Entry)(nil), // 11: google.api.expr.v1alpha1.Expr.CreateStruct.Entry - nil, // 12: google.api.expr.v1alpha1.SourceInfo.PositionsEntry - nil, // 13: google.api.expr.v1alpha1.SourceInfo.MacroCallsEntry - (structpb.NullValue)(0), // 14: google.protobuf.NullValue - (*durationpb.Duration)(nil), // 15: google.protobuf.Duration - (*timestamppb.Timestamp)(nil), // 16: google.protobuf.Timestamp + (SourceInfo_Extension_Component)(0), // 0: google.api.expr.v1alpha1.SourceInfo.Extension.Component + (*ParsedExpr)(nil), // 1: google.api.expr.v1alpha1.ParsedExpr + (*Expr)(nil), // 2: google.api.expr.v1alpha1.Expr + (*Constant)(nil), // 3: google.api.expr.v1alpha1.Constant + (*SourceInfo)(nil), // 4: google.api.expr.v1alpha1.SourceInfo + (*SourcePosition)(nil), // 5: google.api.expr.v1alpha1.SourcePosition + (*Expr_Ident)(nil), // 6: google.api.expr.v1alpha1.Expr.Ident + (*Expr_Select)(nil), // 7: google.api.expr.v1alpha1.Expr.Select + (*Expr_Call)(nil), // 8: google.api.expr.v1alpha1.Expr.Call + (*Expr_CreateList)(nil), // 9: google.api.expr.v1alpha1.Expr.CreateList + (*Expr_CreateStruct)(nil), // 10: google.api.expr.v1alpha1.Expr.CreateStruct + (*Expr_Comprehension)(nil), // 11: google.api.expr.v1alpha1.Expr.Comprehension + (*Expr_CreateStruct_Entry)(nil), // 12: google.api.expr.v1alpha1.Expr.CreateStruct.Entry + (*SourceInfo_Extension)(nil), // 13: google.api.expr.v1alpha1.SourceInfo.Extension + nil, // 14: google.api.expr.v1alpha1.SourceInfo.PositionsEntry + nil, // 15: google.api.expr.v1alpha1.SourceInfo.MacroCallsEntry + (*SourceInfo_Extension_Version)(nil), // 16: google.api.expr.v1alpha1.SourceInfo.Extension.Version + (structpb.NullValue)(0), // 17: google.protobuf.NullValue + (*durationpb.Duration)(nil), // 18: google.protobuf.Duration + (*timestamppb.Timestamp)(nil), // 19: google.protobuf.Timestamp } var file_google_api_expr_v1alpha1_syntax_proto_depIdxs = []int32{ - 1, // 0: google.api.expr.v1alpha1.ParsedExpr.expr:type_name -> google.api.expr.v1alpha1.Expr - 3, // 1: google.api.expr.v1alpha1.ParsedExpr.source_info:type_name -> google.api.expr.v1alpha1.SourceInfo - 2, // 2: google.api.expr.v1alpha1.Expr.const_expr:type_name -> google.api.expr.v1alpha1.Constant - 5, // 3: google.api.expr.v1alpha1.Expr.ident_expr:type_name -> google.api.expr.v1alpha1.Expr.Ident - 6, // 4: google.api.expr.v1alpha1.Expr.select_expr:type_name -> google.api.expr.v1alpha1.Expr.Select - 7, // 5: google.api.expr.v1alpha1.Expr.call_expr:type_name -> google.api.expr.v1alpha1.Expr.Call - 8, // 6: google.api.expr.v1alpha1.Expr.list_expr:type_name -> google.api.expr.v1alpha1.Expr.CreateList - 9, // 7: google.api.expr.v1alpha1.Expr.struct_expr:type_name -> google.api.expr.v1alpha1.Expr.CreateStruct - 10, // 8: google.api.expr.v1alpha1.Expr.comprehension_expr:type_name -> google.api.expr.v1alpha1.Expr.Comprehension - 14, // 9: google.api.expr.v1alpha1.Constant.null_value:type_name -> google.protobuf.NullValue - 15, // 10: google.api.expr.v1alpha1.Constant.duration_value:type_name -> google.protobuf.Duration - 16, // 11: google.api.expr.v1alpha1.Constant.timestamp_value:type_name -> google.protobuf.Timestamp - 12, // 12: google.api.expr.v1alpha1.SourceInfo.positions:type_name -> google.api.expr.v1alpha1.SourceInfo.PositionsEntry - 13, // 13: google.api.expr.v1alpha1.SourceInfo.macro_calls:type_name -> google.api.expr.v1alpha1.SourceInfo.MacroCallsEntry - 1, // 14: google.api.expr.v1alpha1.Expr.Select.operand:type_name -> google.api.expr.v1alpha1.Expr - 1, // 15: google.api.expr.v1alpha1.Expr.Call.target:type_name -> google.api.expr.v1alpha1.Expr - 1, // 16: google.api.expr.v1alpha1.Expr.Call.args:type_name -> google.api.expr.v1alpha1.Expr - 1, // 17: google.api.expr.v1alpha1.Expr.CreateList.elements:type_name -> google.api.expr.v1alpha1.Expr - 11, // 18: google.api.expr.v1alpha1.Expr.CreateStruct.entries:type_name -> google.api.expr.v1alpha1.Expr.CreateStruct.Entry - 1, // 19: google.api.expr.v1alpha1.Expr.Comprehension.iter_range:type_name -> google.api.expr.v1alpha1.Expr - 1, // 20: google.api.expr.v1alpha1.Expr.Comprehension.accu_init:type_name -> google.api.expr.v1alpha1.Expr - 1, // 21: google.api.expr.v1alpha1.Expr.Comprehension.loop_condition:type_name -> google.api.expr.v1alpha1.Expr - 1, // 22: google.api.expr.v1alpha1.Expr.Comprehension.loop_step:type_name -> google.api.expr.v1alpha1.Expr - 1, // 23: google.api.expr.v1alpha1.Expr.Comprehension.result:type_name -> google.api.expr.v1alpha1.Expr - 1, // 24: google.api.expr.v1alpha1.Expr.CreateStruct.Entry.map_key:type_name -> google.api.expr.v1alpha1.Expr - 1, // 25: google.api.expr.v1alpha1.Expr.CreateStruct.Entry.value:type_name -> google.api.expr.v1alpha1.Expr - 1, // 26: google.api.expr.v1alpha1.SourceInfo.MacroCallsEntry.value:type_name -> google.api.expr.v1alpha1.Expr - 27, // [27:27] is the sub-list for method output_type - 27, // [27:27] is the sub-list for method input_type - 27, // [27:27] is the sub-list for extension type_name - 27, // [27:27] is the sub-list for extension extendee - 0, // [0:27] is the sub-list for field type_name + 2, // 0: google.api.expr.v1alpha1.ParsedExpr.expr:type_name -> google.api.expr.v1alpha1.Expr + 4, // 1: google.api.expr.v1alpha1.ParsedExpr.source_info:type_name -> google.api.expr.v1alpha1.SourceInfo + 3, // 2: google.api.expr.v1alpha1.Expr.const_expr:type_name -> google.api.expr.v1alpha1.Constant + 6, // 3: google.api.expr.v1alpha1.Expr.ident_expr:type_name -> google.api.expr.v1alpha1.Expr.Ident + 7, // 4: google.api.expr.v1alpha1.Expr.select_expr:type_name -> google.api.expr.v1alpha1.Expr.Select + 8, // 5: google.api.expr.v1alpha1.Expr.call_expr:type_name -> google.api.expr.v1alpha1.Expr.Call + 9, // 6: google.api.expr.v1alpha1.Expr.list_expr:type_name -> google.api.expr.v1alpha1.Expr.CreateList + 10, // 7: google.api.expr.v1alpha1.Expr.struct_expr:type_name -> google.api.expr.v1alpha1.Expr.CreateStruct + 11, // 8: google.api.expr.v1alpha1.Expr.comprehension_expr:type_name -> google.api.expr.v1alpha1.Expr.Comprehension + 17, // 9: google.api.expr.v1alpha1.Constant.null_value:type_name -> google.protobuf.NullValue + 18, // 10: google.api.expr.v1alpha1.Constant.duration_value:type_name -> google.protobuf.Duration + 19, // 11: google.api.expr.v1alpha1.Constant.timestamp_value:type_name -> google.protobuf.Timestamp + 14, // 12: google.api.expr.v1alpha1.SourceInfo.positions:type_name -> google.api.expr.v1alpha1.SourceInfo.PositionsEntry + 15, // 13: google.api.expr.v1alpha1.SourceInfo.macro_calls:type_name -> google.api.expr.v1alpha1.SourceInfo.MacroCallsEntry + 13, // 14: google.api.expr.v1alpha1.SourceInfo.extensions:type_name -> google.api.expr.v1alpha1.SourceInfo.Extension + 2, // 15: google.api.expr.v1alpha1.Expr.Select.operand:type_name -> google.api.expr.v1alpha1.Expr + 2, // 16: google.api.expr.v1alpha1.Expr.Call.target:type_name -> google.api.expr.v1alpha1.Expr + 2, // 17: google.api.expr.v1alpha1.Expr.Call.args:type_name -> google.api.expr.v1alpha1.Expr + 2, // 18: google.api.expr.v1alpha1.Expr.CreateList.elements:type_name -> google.api.expr.v1alpha1.Expr + 12, // 19: google.api.expr.v1alpha1.Expr.CreateStruct.entries:type_name -> google.api.expr.v1alpha1.Expr.CreateStruct.Entry + 2, // 20: google.api.expr.v1alpha1.Expr.Comprehension.iter_range:type_name -> google.api.expr.v1alpha1.Expr + 2, // 21: google.api.expr.v1alpha1.Expr.Comprehension.accu_init:type_name -> google.api.expr.v1alpha1.Expr + 2, // 22: google.api.expr.v1alpha1.Expr.Comprehension.loop_condition:type_name -> google.api.expr.v1alpha1.Expr + 2, // 23: google.api.expr.v1alpha1.Expr.Comprehension.loop_step:type_name -> google.api.expr.v1alpha1.Expr + 2, // 24: google.api.expr.v1alpha1.Expr.Comprehension.result:type_name -> google.api.expr.v1alpha1.Expr + 2, // 25: google.api.expr.v1alpha1.Expr.CreateStruct.Entry.map_key:type_name -> google.api.expr.v1alpha1.Expr + 2, // 26: google.api.expr.v1alpha1.Expr.CreateStruct.Entry.value:type_name -> google.api.expr.v1alpha1.Expr + 0, // 27: google.api.expr.v1alpha1.SourceInfo.Extension.affected_components:type_name -> google.api.expr.v1alpha1.SourceInfo.Extension.Component + 16, // 28: google.api.expr.v1alpha1.SourceInfo.Extension.version:type_name -> google.api.expr.v1alpha1.SourceInfo.Extension.Version + 2, // 29: google.api.expr.v1alpha1.SourceInfo.MacroCallsEntry.value:type_name -> google.api.expr.v1alpha1.Expr + 30, // [30:30] is the sub-list for method output_type + 30, // [30:30] is the sub-list for method input_type + 30, // [30:30] is the sub-list for extension type_name + 30, // [30:30] is the sub-list for extension extendee + 0, // [0:30] is the sub-list for field type_name } func init() { file_google_api_expr_v1alpha1_syntax_proto_init() } @@ -1674,6 +1969,30 @@ func file_google_api_expr_v1alpha1_syntax_proto_init() { return nil } } + file_google_api_expr_v1alpha1_syntax_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*SourceInfo_Extension); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_google_api_expr_v1alpha1_syntax_proto_msgTypes[15].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*SourceInfo_Extension_Version); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } } file_google_api_expr_v1alpha1_syntax_proto_msgTypes[1].OneofWrappers = []interface{}{ (*Expr_ConstExpr)(nil), @@ -1704,13 +2023,14 @@ func file_google_api_expr_v1alpha1_syntax_proto_init() { File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_api_expr_v1alpha1_syntax_proto_rawDesc, - NumEnums: 0, - NumMessages: 14, + NumEnums: 1, + NumMessages: 16, NumExtensions: 0, NumServices: 0, }, GoTypes: file_google_api_expr_v1alpha1_syntax_proto_goTypes, DependencyIndexes: file_google_api_expr_v1alpha1_syntax_proto_depIdxs, + EnumInfos: file_google_api_expr_v1alpha1_syntax_proto_enumTypes, MessageInfos: file_google_api_expr_v1alpha1_syntax_proto_msgTypes, }.Build() File_google_api_expr_v1alpha1_syntax_proto = out.File diff --git a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/value.pb.go b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/value.pb.go index 91d122c5..0a5ca6a1 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/value.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/expr/v1alpha1/value.pb.go @@ -1,4 +1,4 @@ -// Copyright 2022 Google LLC +// Copyright 2024 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -15,7 +15,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.26.0 -// protoc v3.21.5 +// protoc v4.24.4 // source: google/api/expr/v1alpha1/value.proto package expr diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go index a6b50818..6ad1b1c1 100644 --- a/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go @@ -1,4 +1,4 @@ -// Copyright 2022 Google LLC +// Copyright 2024 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -15,7 +15,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: // protoc-gen-go v1.26.0 -// protoc v3.21.9 +// protoc v4.24.4 // source: google/rpc/status.proto package status diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/decode.go b/vendor/google.golang.org/protobuf/encoding/protojson/decode.go index f4790237..bb2966e3 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/decode.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/decode.go @@ -102,7 +102,7 @@ type decoder struct { } // newError returns an error object with position info. -func (d decoder) newError(pos int, f string, x ...interface{}) error { +func (d decoder) newError(pos int, f string, x ...any) error { line, column := d.Position(pos) head := fmt.Sprintf("(line %d:%d): ", line, column) return errors.New(head+f, x...) @@ -114,7 +114,7 @@ func (d decoder) unexpectedTokenError(tok json.Token) error { } // syntaxError returns a syntax error for given position. -func (d decoder) syntaxError(pos int, f string, x ...interface{}) error { +func (d decoder) syntaxError(pos int, f string, x ...any) error { line, column := d.Position(pos) head := fmt.Sprintf("syntax error (line %d:%d): ", line, column) return errors.New(head+f, x...) diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/encode.go b/vendor/google.golang.org/protobuf/encoding/protojson/encode.go index 3f75098b..29846df2 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/encode.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/encode.go @@ -25,15 +25,17 @@ const defaultIndent = " " // Format formats the message as a multiline string. // This function is only intended for human consumption and ignores errors. -// Do not depend on the output being stable. It may change over time across -// different versions of the program. +// Do not depend on the output being stable. Its output will change across +// different builds of your program, even when using the same version of the +// protobuf module. func Format(m proto.Message) string { return MarshalOptions{Multiline: true}.Format(m) } // Marshal writes the given [proto.Message] in JSON format using default options. -// Do not depend on the output being stable. It may change over time across -// different versions of the program. +// Do not depend on the output being stable. Its output will change across +// different builds of your program, even when using the same version of the +// protobuf module. func Marshal(m proto.Message) ([]byte, error) { return MarshalOptions{}.Marshal(m) } @@ -110,8 +112,9 @@ type MarshalOptions struct { // Format formats the message as a string. // This method is only intended for human consumption and ignores errors. -// Do not depend on the output being stable. It may change over time across -// different versions of the program. +// Do not depend on the output being stable. Its output will change across +// different builds of your program, even when using the same version of the +// protobuf module. func (o MarshalOptions) Format(m proto.Message) string { if m == nil || !m.ProtoReflect().IsValid() { return "" // invalid syntax, but okay since this is for debugging @@ -122,8 +125,9 @@ func (o MarshalOptions) Format(m proto.Message) string { } // Marshal marshals the given [proto.Message] in the JSON format using options in -// MarshalOptions. Do not depend on the output being stable. It may change over -// time across different versions of the program. +// Do not depend on the output being stable. Its output will change across +// different builds of your program, even when using the same version of the +// protobuf module. func (o MarshalOptions) Marshal(m proto.Message) ([]byte, error) { return o.marshal(nil, m) } diff --git a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go index a45f112b..24bc98ac 100644 --- a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go +++ b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go @@ -84,7 +84,7 @@ type decoder struct { } // newError returns an error object with position info. -func (d decoder) newError(pos int, f string, x ...interface{}) error { +func (d decoder) newError(pos int, f string, x ...any) error { line, column := d.Position(pos) head := fmt.Sprintf("(line %d:%d): ", line, column) return errors.New(head+f, x...) @@ -96,7 +96,7 @@ func (d decoder) unexpectedTokenError(tok text.Token) error { } // syntaxError returns a syntax error for given position. -func (d decoder) syntaxError(pos int, f string, x ...interface{}) error { +func (d decoder) syntaxError(pos int, f string, x ...any) error { line, column := d.Position(pos) head := fmt.Sprintf("syntax error (line %d:%d): ", line, column) return errors.New(head+f, x...) diff --git a/vendor/google.golang.org/protobuf/encoding/prototext/encode.go b/vendor/google.golang.org/protobuf/encoding/prototext/encode.go index 95967e81..1f57e661 100644 --- a/vendor/google.golang.org/protobuf/encoding/prototext/encode.go +++ b/vendor/google.golang.org/protobuf/encoding/prototext/encode.go @@ -27,15 +27,17 @@ const defaultIndent = " " // Format formats the message as a multiline string. // This function is only intended for human consumption and ignores errors. -// Do not depend on the output being stable. It may change over time across -// different versions of the program. +// Do not depend on the output being stable. Its output will change across +// different builds of your program, even when using the same version of the +// protobuf module. func Format(m proto.Message) string { return MarshalOptions{Multiline: true}.Format(m) } // Marshal writes the given [proto.Message] in textproto format using default -// options. Do not depend on the output being stable. It may change over time -// across different versions of the program. +// options. Do not depend on the output being stable. Its output will change +// across different builds of your program, even when using the same version of +// the protobuf module. func Marshal(m proto.Message) ([]byte, error) { return MarshalOptions{}.Marshal(m) } @@ -84,8 +86,9 @@ type MarshalOptions struct { // Format formats the message as a string. // This method is only intended for human consumption and ignores errors. -// Do not depend on the output being stable. It may change over time across -// different versions of the program. +// Do not depend on the output being stable. Its output will change across +// different builds of your program, even when using the same version of the +// protobuf module. func (o MarshalOptions) Format(m proto.Message) string { if m == nil || !m.ProtoReflect().IsValid() { return "" // invalid syntax, but okay since this is for debugging @@ -98,8 +101,9 @@ func (o MarshalOptions) Format(m proto.Message) string { } // Marshal writes the given [proto.Message] in textproto format using options in -// MarshalOptions object. Do not depend on the output being stable. It may -// change over time across different versions of the program. +// MarshalOptions object. Do not depend on the output being stable. Its output +// will change across different builds of your program, even when using the +// same version of the protobuf module. func (o MarshalOptions) Marshal(m proto.Message) ([]byte, error) { return o.marshal(nil, m) } diff --git a/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go b/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go index a45625c8..87e46bd4 100644 --- a/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go +++ b/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go @@ -252,6 +252,7 @@ func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool, record fu {rv.MethodByName("Values"), "Values"}, {rv.MethodByName("ReservedNames"), "ReservedNames"}, {rv.MethodByName("ReservedRanges"), "ReservedRanges"}, + {rv.MethodByName("IsClosed"), "IsClosed"}, }...) case protoreflect.EnumValueDescriptor: diff --git a/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb b/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb index 18f0756874367adcdb790ffde125b6a7388b4eaa..ff6a38360add36f53d48bb0863b701696e0d7b2d 100644 GIT binary patch literal 93 zcmd;*mUzal#C*w)K}(Q>QGiK;Nr72|(SYfa9TNv5m$bxlxFnMRqXeS@6Ht;7B*_4j Ve8H{+(u69m1u{(G8N0>{b^xZ!4_5#H literal 63 zcmd-Q6yo7v6kw8IQef6#G+>f=#?A#2ViI7KU{qiN3NcDNhX^qu3B6!fc*d^rf*k<7 Cln3+x diff --git a/vendor/google.golang.org/protobuf/internal/editionssupport/editions.go b/vendor/google.golang.org/protobuf/internal/editionssupport/editions.go new file mode 100644 index 00000000..029a6a12 --- /dev/null +++ b/vendor/google.golang.org/protobuf/internal/editionssupport/editions.go @@ -0,0 +1,13 @@ +// Copyright 2024 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package editionssupport defines constants for editions that are supported. +package editionssupport + +import descriptorpb "google.golang.org/protobuf/types/descriptorpb" + +const ( + Minimum = descriptorpb.Edition_EDITION_PROTO2 + Maximum = descriptorpb.Edition_EDITION_2023 +) diff --git a/vendor/google.golang.org/protobuf/internal/encoding/json/decode.go b/vendor/google.golang.org/protobuf/internal/encoding/json/decode.go index d2b3ac03..ea1d3e65 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/json/decode.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/json/decode.go @@ -214,7 +214,7 @@ func (d *Decoder) parseNext() (Token, error) { // newSyntaxError returns an error with line and column information useful for // syntax errors. -func (d *Decoder) newSyntaxError(pos int, f string, x ...interface{}) error { +func (d *Decoder) newSyntaxError(pos int, f string, x ...any) error { e := errors.New(f, x...) line, column := d.Position(pos) return errors.New("syntax error (line %d:%d): %v", line, column, e) diff --git a/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go b/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go index 373d2083..7e87c760 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go @@ -32,6 +32,7 @@ var byteType = reflect.TypeOf(byte(0)) func Unmarshal(tag string, goType reflect.Type, evs protoreflect.EnumValueDescriptors) protoreflect.FieldDescriptor { f := new(filedesc.Field) f.L0.ParentFile = filedesc.SurrogateProto2 + f.L1.EditionFeatures = f.L0.ParentFile.L1.EditionFeatures for len(tag) > 0 { i := strings.IndexByte(tag, ',') if i < 0 { @@ -107,8 +108,7 @@ func Unmarshal(tag string, goType reflect.Type, evs protoreflect.EnumValueDescri f.L1.StringName.InitJSON(jsonName) } case s == "packed": - f.L1.HasPacked = true - f.L1.IsPacked = true + f.L1.EditionFeatures.IsPacked = true case strings.HasPrefix(s, "weak="): f.L1.IsWeak = true f.L1.Message = filedesc.PlaceholderMessage(protoreflect.FullName(s[len("weak="):])) diff --git a/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go b/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go index 87853e78..099b2bf4 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go @@ -601,7 +601,7 @@ func (d *Decoder) consumeToken(kind Kind, size int, attrs uint8) Token { // newSyntaxError returns a syntax error with line and column information for // current position. -func (d *Decoder) newSyntaxError(f string, x ...interface{}) error { +func (d *Decoder) newSyntaxError(f string, x ...any) error { e := errors.New(f, x...) line, column := d.Position(len(d.orig) - len(d.in)) return errors.New("syntax error (line %d:%d): %v", line, column, e) diff --git a/vendor/google.golang.org/protobuf/internal/errors/errors.go b/vendor/google.golang.org/protobuf/internal/errors/errors.go index 20c17b35..c2d6bd52 100644 --- a/vendor/google.golang.org/protobuf/internal/errors/errors.go +++ b/vendor/google.golang.org/protobuf/internal/errors/errors.go @@ -17,7 +17,7 @@ var Error = errors.New("protobuf error") // New formats a string according to the format specifier and arguments and // returns an error that has a "proto" prefix. -func New(f string, x ...interface{}) error { +func New(f string, x ...any) error { return &prefixError{s: format(f, x...)} } @@ -43,7 +43,7 @@ func (e *prefixError) Unwrap() error { // Wrap returns an error that has a "proto" prefix, the formatted string described // by the format specifier and arguments, and a suffix of err. The error wraps err. -func Wrap(err error, f string, x ...interface{}) error { +func Wrap(err error, f string, x ...any) error { return &wrapError{ s: format(f, x...), err: err, @@ -67,7 +67,7 @@ func (e *wrapError) Is(target error) bool { return target == Error } -func format(f string, x ...interface{}) string { +func format(f string, x ...any) string { // avoid "proto: " prefix when chaining for i := 0; i < len(x); i++ { switch e := x[i].(type) { @@ -87,3 +87,18 @@ func InvalidUTF8(name string) error { func RequiredNotSet(name string) error { return New("required field %v not set", name) } + +type SizeMismatchError struct { + Calculated, Measured int +} + +func (e *SizeMismatchError) Error() string { + return fmt.Sprintf("size mismatch (see https://github.com/golang/protobuf/issues/1609): calculated=%d, measured=%d", e.Calculated, e.Measured) +} + +func MismatchedSizeCalculation(calculated, measured int) error { + return &SizeMismatchError{ + Calculated: calculated, + Measured: measured, + } +} diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go index 8826bcf4..df53ff40 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go @@ -7,6 +7,7 @@ package filedesc import ( "bytes" "fmt" + "strings" "sync" "sync/atomic" @@ -108,9 +109,12 @@ func (fd *File) ParentFile() protoreflect.FileDescriptor { return fd } func (fd *File) Parent() protoreflect.Descriptor { return nil } func (fd *File) Index() int { return 0 } func (fd *File) Syntax() protoreflect.Syntax { return fd.L1.Syntax } -func (fd *File) Name() protoreflect.Name { return fd.L1.Package.Name() } -func (fd *File) FullName() protoreflect.FullName { return fd.L1.Package } -func (fd *File) IsPlaceholder() bool { return false } + +// Not exported and just used to reconstruct the original FileDescriptor proto +func (fd *File) Edition() int32 { return int32(fd.L1.Edition) } +func (fd *File) Name() protoreflect.Name { return fd.L1.Package.Name() } +func (fd *File) FullName() protoreflect.FullName { return fd.L1.Package } +func (fd *File) IsPlaceholder() bool { return false } func (fd *File) Options() protoreflect.ProtoMessage { if f := fd.lazyInit().Options; f != nil { return f() @@ -202,6 +206,9 @@ func (ed *Enum) lazyInit() *EnumL2 { ed.L0.ParentFile.lazyInit() // implicitly initializes L2 return ed.L2 } +func (ed *Enum) IsClosed() bool { + return !ed.L1.EditionFeatures.IsOpenEnum +} func (ed *EnumValue) Options() protoreflect.ProtoMessage { if f := ed.L1.Options; f != nil { @@ -251,10 +258,6 @@ type ( StringName stringName IsProto3Optional bool // promoted from google.protobuf.FieldDescriptorProto IsWeak bool // promoted from google.protobuf.FieldOptions - HasPacked bool // promoted from google.protobuf.FieldOptions - IsPacked bool // promoted from google.protobuf.FieldOptions - HasEnforceUTF8 bool // promoted from google.protobuf.FieldOptions - EnforceUTF8 bool // promoted from google.protobuf.FieldOptions Default defaultValue ContainingOneof protoreflect.OneofDescriptor // must be consistent with Message.Oneofs.Fields Enum protoreflect.EnumDescriptor @@ -331,8 +334,7 @@ func (fd *Field) HasPresence() bool { if fd.L1.Cardinality == protoreflect.Repeated { return false } - explicitFieldPresence := fd.Syntax() == protoreflect.Editions && fd.L1.EditionFeatures.IsFieldPresence - return fd.Syntax() == protoreflect.Proto2 || explicitFieldPresence || fd.L1.Message != nil || fd.L1.ContainingOneof != nil + return fd.IsExtension() || fd.L1.EditionFeatures.IsFieldPresence || fd.L1.Message != nil || fd.L1.ContainingOneof != nil } func (fd *Field) HasOptionalKeyword() bool { return (fd.L0.ParentFile.L1.Syntax == protoreflect.Proto2 && fd.L1.Cardinality == protoreflect.Optional && fd.L1.ContainingOneof == nil) || fd.L1.IsProto3Optional @@ -345,14 +347,7 @@ func (fd *Field) IsPacked() bool { case protoreflect.StringKind, protoreflect.BytesKind, protoreflect.MessageKind, protoreflect.GroupKind: return false } - if fd.L0.ParentFile.L1.Syntax == protoreflect.Editions { - return fd.L1.EditionFeatures.IsPacked - } - if fd.L0.ParentFile.L1.Syntax == protoreflect.Proto3 { - // proto3 repeated fields are packed by default. - return !fd.L1.HasPacked || fd.L1.IsPacked - } - return fd.L1.IsPacked + return fd.L1.EditionFeatures.IsPacked } func (fd *Field) IsExtension() bool { return false } func (fd *Field) IsWeak() bool { return fd.L1.IsWeak } @@ -388,6 +383,10 @@ func (fd *Field) Message() protoreflect.MessageDescriptor { } return fd.L1.Message } +func (fd *Field) IsMapEntry() bool { + parent, ok := fd.L0.Parent.(protoreflect.MessageDescriptor) + return ok && parent.IsMapEntry() +} func (fd *Field) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, fd) } func (fd *Field) ProtoType(protoreflect.FieldDescriptor) {} @@ -399,13 +398,7 @@ func (fd *Field) ProtoType(protoreflect.FieldDescriptor) {} // WARNING: This method is exempt from the compatibility promise and may be // removed in the future without warning. func (fd *Field) EnforceUTF8() bool { - if fd.L0.ParentFile.L1.Syntax == protoreflect.Editions { - return fd.L1.EditionFeatures.IsUTF8Validated - } - if fd.L1.HasEnforceUTF8 { - return fd.L1.EnforceUTF8 - } - return fd.L0.ParentFile.L1.Syntax == protoreflect.Proto3 + return fd.L1.EditionFeatures.IsUTF8Validated } func (od *Oneof) IsSynthetic() bool { @@ -438,7 +431,6 @@ type ( Options func() protoreflect.ProtoMessage StringName stringName IsProto3Optional bool // promoted from google.protobuf.FieldDescriptorProto - IsPacked bool // promoted from google.protobuf.FieldOptions Default defaultValue Enum protoreflect.EnumDescriptor Message protoreflect.MessageDescriptor @@ -461,7 +453,16 @@ func (xd *Extension) HasPresence() bool { return xd.L1.Cardi func (xd *Extension) HasOptionalKeyword() bool { return (xd.L0.ParentFile.L1.Syntax == protoreflect.Proto2 && xd.L1.Cardinality == protoreflect.Optional) || xd.lazyInit().IsProto3Optional } -func (xd *Extension) IsPacked() bool { return xd.lazyInit().IsPacked } +func (xd *Extension) IsPacked() bool { + if xd.L1.Cardinality != protoreflect.Repeated { + return false + } + switch xd.L1.Kind { + case protoreflect.StringKind, protoreflect.BytesKind, protoreflect.MessageKind, protoreflect.GroupKind: + return false + } + return xd.L1.EditionFeatures.IsPacked +} func (xd *Extension) IsExtension() bool { return true } func (xd *Extension) IsWeak() bool { return false } func (xd *Extension) IsList() bool { return xd.Cardinality() == protoreflect.Repeated } @@ -542,8 +543,9 @@ func (md *Method) ProtoInternal(pragma.DoNotImplement) {} // Surrogate files are can be used to create standalone descriptors // where the syntax is only information derived from the parent file. var ( - SurrogateProto2 = &File{L1: FileL1{Syntax: protoreflect.Proto2}, L2: &FileL2{}} - SurrogateProto3 = &File{L1: FileL1{Syntax: protoreflect.Proto3}, L2: &FileL2{}} + SurrogateProto2 = &File{L1: FileL1{Syntax: protoreflect.Proto2}, L2: &FileL2{}} + SurrogateProto3 = &File{L1: FileL1{Syntax: protoreflect.Proto3}, L2: &FileL2{}} + SurrogateEdition2023 = &File{L1: FileL1{Syntax: protoreflect.Editions, Edition: Edition2023}, L2: &FileL2{}} ) type ( @@ -585,6 +587,34 @@ func (s *stringName) InitJSON(name string) { s.nameJSON = name } +// Returns true if this field is structured like the synthetic field of a proto2 +// group. This allows us to expand our treatment of delimited fields without +// breaking proto2 files that have been upgraded to editions. +func isGroupLike(fd protoreflect.FieldDescriptor) bool { + // Groups are always group types. + if fd.Kind() != protoreflect.GroupKind { + return false + } + + // Group fields are always the lowercase type name. + if strings.ToLower(string(fd.Message().Name())) != string(fd.Name()) { + return false + } + + // Groups could only be defined in the same file they're used. + if fd.Message().ParentFile() != fd.ParentFile() { + return false + } + + // Group messages are always defined in the same scope as the field. File + // level extensions will compare NULL == NULL here, which is why the file + // comparison above is necessary to ensure both come from the same file. + if fd.IsExtension() { + return fd.Parent() == fd.Message().Parent() + } + return fd.ContainingMessage() == fd.Message().Parent() +} + func (s *stringName) lazyInit(fd protoreflect.FieldDescriptor) *stringName { s.once.Do(func() { if fd.IsExtension() { @@ -605,7 +635,7 @@ func (s *stringName) lazyInit(fd protoreflect.FieldDescriptor) *stringName { // Format the text name. s.nameText = string(fd.Name()) - if fd.Kind() == protoreflect.GroupKind { + if isGroupLike(fd) { s.nameText = string(fd.Message().Name()) } } diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go index 237e64fd..8a57d60b 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go @@ -113,8 +113,10 @@ func (fd *File) unmarshalSeed(b []byte) { switch string(v) { case "proto2": fd.L1.Syntax = protoreflect.Proto2 + fd.L1.Edition = EditionProto2 case "proto3": fd.L1.Syntax = protoreflect.Proto3 + fd.L1.Edition = EditionProto3 case "editions": fd.L1.Syntax = protoreflect.Editions default: @@ -177,11 +179,10 @@ func (fd *File) unmarshalSeed(b []byte) { // If syntax is missing, it is assumed to be proto2. if fd.L1.Syntax == 0 { fd.L1.Syntax = protoreflect.Proto2 + fd.L1.Edition = EditionProto2 } - if fd.L1.Syntax == protoreflect.Editions { - fd.L1.EditionFeatures = getFeaturesFor(fd.L1.Edition) - } + fd.L1.EditionFeatures = getFeaturesFor(fd.L1.Edition) // Parse editions features from options if any if options != nil { @@ -267,6 +268,7 @@ func (ed *Enum) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protorefl ed.L0.ParentFile = pf ed.L0.Parent = pd ed.L0.Index = i + ed.L1.EditionFeatures = featuresFromParentDesc(ed.Parent()) var numValues int for b := b; len(b) > 0; { @@ -443,6 +445,7 @@ func (xd *Extension) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd prot xd.L0.ParentFile = pf xd.L0.Parent = pd xd.L0.Index = i + xd.L1.EditionFeatures = featuresFromParentDesc(pd) for len(b) > 0 { num, typ, n := protowire.ConsumeTag(b) @@ -467,6 +470,38 @@ func (xd *Extension) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd prot xd.L0.FullName = appendFullName(sb, pd.FullName(), v) case genid.FieldDescriptorProto_Extendee_field_number: xd.L1.Extendee = PlaceholderMessage(makeFullName(sb, v)) + case genid.FieldDescriptorProto_Options_field_number: + xd.unmarshalOptions(v) + } + default: + m := protowire.ConsumeFieldValue(num, typ, b) + b = b[m:] + } + } + + if xd.L1.Kind == protoreflect.MessageKind && xd.L1.EditionFeatures.IsDelimitedEncoded { + xd.L1.Kind = protoreflect.GroupKind + } +} + +func (xd *Extension) unmarshalOptions(b []byte) { + for len(b) > 0 { + num, typ, n := protowire.ConsumeTag(b) + b = b[n:] + switch typ { + case protowire.VarintType: + v, m := protowire.ConsumeVarint(b) + b = b[m:] + switch num { + case genid.FieldOptions_Packed_field_number: + xd.L1.EditionFeatures.IsPacked = protowire.DecodeBool(v) + } + case protowire.BytesType: + v, m := protowire.ConsumeBytes(b) + b = b[m:] + switch num { + case genid.FieldOptions_Features_field_number: + xd.L1.EditionFeatures = unmarshalFeatureSet(v, xd.L1.EditionFeatures) } default: m := protowire.ConsumeFieldValue(num, typ, b) @@ -499,7 +534,7 @@ func (sd *Service) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protor } var nameBuilderPool = sync.Pool{ - New: func() interface{} { return new(strs.Builder) }, + New: func() any { return new(strs.Builder) }, } func getBuilder() *strs.Builder { diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go index 482a61cc..e56c91a8 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go @@ -45,6 +45,11 @@ func (file *File) resolveMessages() { case protoreflect.MessageKind, protoreflect.GroupKind: fd.L1.Message = file.resolveMessageDependency(fd.L1.Message, listFieldDeps, depIdx) depIdx++ + if fd.L1.Kind == protoreflect.GroupKind && (fd.IsMap() || fd.IsMapEntry()) { + // A map field might inherit delimited encoding from a file-wide default feature. + // But maps never actually use delimited encoding. (At least for now...) + fd.L1.Kind = protoreflect.MessageKind + } } // Default is resolved here since it depends on Enum being resolved. @@ -466,10 +471,10 @@ func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoref b = b[m:] } } - if fd.Syntax() == protoreflect.Editions && fd.L1.Kind == protoreflect.MessageKind && fd.L1.EditionFeatures.IsDelimitedEncoded { + if fd.L1.Kind == protoreflect.MessageKind && fd.L1.EditionFeatures.IsDelimitedEncoded { fd.L1.Kind = protoreflect.GroupKind } - if fd.Syntax() == protoreflect.Editions && fd.L1.EditionFeatures.IsLegacyRequired { + if fd.L1.EditionFeatures.IsLegacyRequired { fd.L1.Cardinality = protoreflect.Required } if rawTypeName != nil { @@ -496,13 +501,11 @@ func (fd *Field) unmarshalOptions(b []byte) { b = b[m:] switch num { case genid.FieldOptions_Packed_field_number: - fd.L1.HasPacked = true - fd.L1.IsPacked = protowire.DecodeBool(v) + fd.L1.EditionFeatures.IsPacked = protowire.DecodeBool(v) case genid.FieldOptions_Weak_field_number: fd.L1.IsWeak = protowire.DecodeBool(v) case FieldOptions_EnforceUTF8: - fd.L1.HasEnforceUTF8 = true - fd.L1.EnforceUTF8 = protowire.DecodeBool(v) + fd.L1.EditionFeatures.IsUTF8Validated = protowire.DecodeBool(v) } case protowire.BytesType: v, m := protowire.ConsumeBytes(b) @@ -548,7 +551,6 @@ func (od *Oneof) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoref func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) { var rawTypeName []byte var rawOptions []byte - xd.L1.EditionFeatures = featuresFromParentDesc(xd.L1.Extendee) xd.L2 = new(ExtensionL2) for len(b) > 0 { num, typ, n := protowire.ConsumeTag(b) @@ -572,7 +574,6 @@ func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) { case genid.FieldDescriptorProto_TypeName_field_number: rawTypeName = v case genid.FieldDescriptorProto_Options_field_number: - xd.unmarshalOptions(v) rawOptions = appendOptions(rawOptions, v) } default: @@ -580,12 +581,6 @@ func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) { b = b[m:] } } - if xd.Syntax() == protoreflect.Editions && xd.L1.Kind == protoreflect.MessageKind && xd.L1.EditionFeatures.IsDelimitedEncoded { - xd.L1.Kind = protoreflect.GroupKind - } - if xd.Syntax() == protoreflect.Editions && xd.L1.EditionFeatures.IsLegacyRequired { - xd.L1.Cardinality = protoreflect.Required - } if rawTypeName != nil { name := makeFullName(sb, rawTypeName) switch xd.L1.Kind { @@ -598,32 +593,6 @@ func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) { xd.L2.Options = xd.L0.ParentFile.builder.optionsUnmarshaler(&descopts.Field, rawOptions) } -func (xd *Extension) unmarshalOptions(b []byte) { - for len(b) > 0 { - num, typ, n := protowire.ConsumeTag(b) - b = b[n:] - switch typ { - case protowire.VarintType: - v, m := protowire.ConsumeVarint(b) - b = b[m:] - switch num { - case genid.FieldOptions_Packed_field_number: - xd.L2.IsPacked = protowire.DecodeBool(v) - } - case protowire.BytesType: - v, m := protowire.ConsumeBytes(b) - b = b[m:] - switch num { - case genid.FieldOptions_Features_field_number: - xd.L1.EditionFeatures = unmarshalFeatureSet(v, xd.L1.EditionFeatures) - } - default: - m := protowire.ConsumeFieldValue(num, typ, b) - b = b[m:] - } - } -} - func (sd *Service) unmarshalFull(b []byte, sb *strs.Builder) { var rawMethods [][]byte var rawOptions []byte diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_list_gen.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_list_gen.go index 30db19fd..f4107c05 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_list_gen.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_list_gen.go @@ -8,6 +8,7 @@ package filedesc import ( "fmt" + "strings" "sync" "google.golang.org/protobuf/internal/descfmt" @@ -198,6 +199,16 @@ func (p *Fields) lazyInit() *Fields { if _, ok := p.byText[d.TextName()]; !ok { p.byText[d.TextName()] = d } + if isGroupLike(d) { + lowerJSONName := strings.ToLower(d.JSONName()) + if _, ok := p.byJSON[lowerJSONName]; !ok { + p.byJSON[lowerJSONName] = d + } + lowerTextName := strings.ToLower(d.TextName()) + if _, ok := p.byText[lowerTextName]; !ok { + p.byText[lowerTextName] = d + } + } if _, ok := p.byNum[d.Number()]; !ok { p.byNum[d.Number()] = d } diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/editions.go b/vendor/google.golang.org/protobuf/internal/filedesc/editions.go index 0375a49d..11f5f356 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/editions.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/editions.go @@ -14,9 +14,13 @@ import ( ) var defaultsCache = make(map[Edition]EditionFeatures) +var defaultsKeys = []Edition{} func init() { unmarshalEditionDefaults(editiondefaults.Defaults) + SurrogateProto2.L1.EditionFeatures = getFeaturesFor(EditionProto2) + SurrogateProto3.L1.EditionFeatures = getFeaturesFor(EditionProto3) + SurrogateEdition2023.L1.EditionFeatures = getFeaturesFor(Edition2023) } func unmarshalGoFeature(b []byte, parent EditionFeatures) EditionFeatures { @@ -104,12 +108,15 @@ func unmarshalEditionDefault(b []byte) { v, m := protowire.ConsumeBytes(b) b = b[m:] switch num { - case genid.FeatureSetDefaults_FeatureSetEditionDefault_Features_field_number: + case genid.FeatureSetDefaults_FeatureSetEditionDefault_FixedFeatures_field_number: + fs = unmarshalFeatureSet(v, fs) + case genid.FeatureSetDefaults_FeatureSetEditionDefault_OverridableFeatures_field_number: fs = unmarshalFeatureSet(v, fs) } } } defaultsCache[ed] = fs + defaultsKeys = append(defaultsKeys, ed) } func unmarshalEditionDefaults(b []byte) { @@ -135,8 +142,15 @@ func unmarshalEditionDefaults(b []byte) { } func getFeaturesFor(ed Edition) EditionFeatures { - if def, ok := defaultsCache[ed]; ok { - return def + match := EditionUnknown + for _, key := range defaultsKeys { + if key > ed { + break + } + match = key + } + if match == EditionUnknown { + panic(fmt.Sprintf("unsupported edition: %v", ed)) } - panic(fmt.Sprintf("unsupported edition: %v", ed)) + return defaultsCache[match] } diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/placeholder.go b/vendor/google.golang.org/protobuf/internal/filedesc/placeholder.go index 28240ebc..bfb3b841 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/placeholder.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/placeholder.go @@ -63,6 +63,7 @@ func (e PlaceholderEnum) Options() protoreflect.ProtoMessage { return des func (e PlaceholderEnum) Values() protoreflect.EnumValueDescriptors { return emptyEnumValues } func (e PlaceholderEnum) ReservedNames() protoreflect.Names { return emptyNames } func (e PlaceholderEnum) ReservedRanges() protoreflect.EnumRanges { return emptyEnumRanges } +func (e PlaceholderEnum) IsClosed() bool { return false } func (e PlaceholderEnum) ProtoType(protoreflect.EnumDescriptor) { return } func (e PlaceholderEnum) ProtoInternal(pragma.DoNotImplement) { return } diff --git a/vendor/google.golang.org/protobuf/internal/filetype/build.go b/vendor/google.golang.org/protobuf/internal/filetype/build.go index f0e38c4e..ba83fea4 100644 --- a/vendor/google.golang.org/protobuf/internal/filetype/build.go +++ b/vendor/google.golang.org/protobuf/internal/filetype/build.go @@ -68,7 +68,7 @@ type Builder struct { // and for input and output messages referenced by service methods. // Dependencies must come after declarations, but the ordering of // dependencies themselves is unspecified. - GoTypes []interface{} + GoTypes []any // DependencyIndexes is an ordered list of indexes into GoTypes for the // dependencies of messages, extensions, or services. @@ -268,7 +268,7 @@ func (x depIdxs) Get(i, j int32) int32 { type ( resolverByIndex struct { - goTypes []interface{} + goTypes []any depIdxs depIdxs fileRegistry } diff --git a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go index 40272c89..f30ab6b5 100644 --- a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go +++ b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go @@ -21,6 +21,7 @@ const ( // Enum values for google.protobuf.Edition. const ( Edition_EDITION_UNKNOWN_enum_value = 0 + Edition_EDITION_LEGACY_enum_value = 900 Edition_EDITION_PROTO2_enum_value = 998 Edition_EDITION_PROTO3_enum_value = 999 Edition_EDITION_2023_enum_value = 1000 @@ -653,6 +654,7 @@ const ( FieldOptions_Targets_field_name protoreflect.Name = "targets" FieldOptions_EditionDefaults_field_name protoreflect.Name = "edition_defaults" FieldOptions_Features_field_name protoreflect.Name = "features" + FieldOptions_FeatureSupport_field_name protoreflect.Name = "feature_support" FieldOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" FieldOptions_Ctype_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.ctype" @@ -667,6 +669,7 @@ const ( FieldOptions_Targets_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.targets" FieldOptions_EditionDefaults_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.edition_defaults" FieldOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.features" + FieldOptions_FeatureSupport_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.feature_support" FieldOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.uninterpreted_option" ) @@ -684,6 +687,7 @@ const ( FieldOptions_Targets_field_number protoreflect.FieldNumber = 19 FieldOptions_EditionDefaults_field_number protoreflect.FieldNumber = 20 FieldOptions_Features_field_number protoreflect.FieldNumber = 21 + FieldOptions_FeatureSupport_field_number protoreflect.FieldNumber = 22 FieldOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -767,6 +771,33 @@ const ( FieldOptions_EditionDefault_Value_field_number protoreflect.FieldNumber = 2 ) +// Names for google.protobuf.FieldOptions.FeatureSupport. +const ( + FieldOptions_FeatureSupport_message_name protoreflect.Name = "FeatureSupport" + FieldOptions_FeatureSupport_message_fullname protoreflect.FullName = "google.protobuf.FieldOptions.FeatureSupport" +) + +// Field names for google.protobuf.FieldOptions.FeatureSupport. +const ( + FieldOptions_FeatureSupport_EditionIntroduced_field_name protoreflect.Name = "edition_introduced" + FieldOptions_FeatureSupport_EditionDeprecated_field_name protoreflect.Name = "edition_deprecated" + FieldOptions_FeatureSupport_DeprecationWarning_field_name protoreflect.Name = "deprecation_warning" + FieldOptions_FeatureSupport_EditionRemoved_field_name protoreflect.Name = "edition_removed" + + FieldOptions_FeatureSupport_EditionIntroduced_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.FeatureSupport.edition_introduced" + FieldOptions_FeatureSupport_EditionDeprecated_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.FeatureSupport.edition_deprecated" + FieldOptions_FeatureSupport_DeprecationWarning_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.FeatureSupport.deprecation_warning" + FieldOptions_FeatureSupport_EditionRemoved_field_fullname protoreflect.FullName = "google.protobuf.FieldOptions.FeatureSupport.edition_removed" +) + +// Field numbers for google.protobuf.FieldOptions.FeatureSupport. +const ( + FieldOptions_FeatureSupport_EditionIntroduced_field_number protoreflect.FieldNumber = 1 + FieldOptions_FeatureSupport_EditionDeprecated_field_number protoreflect.FieldNumber = 2 + FieldOptions_FeatureSupport_DeprecationWarning_field_number protoreflect.FieldNumber = 3 + FieldOptions_FeatureSupport_EditionRemoved_field_number protoreflect.FieldNumber = 4 +) + // Names for google.protobuf.OneofOptions. const ( OneofOptions_message_name protoreflect.Name = "OneofOptions" @@ -829,11 +860,13 @@ const ( EnumValueOptions_Deprecated_field_name protoreflect.Name = "deprecated" EnumValueOptions_Features_field_name protoreflect.Name = "features" EnumValueOptions_DebugRedact_field_name protoreflect.Name = "debug_redact" + EnumValueOptions_FeatureSupport_field_name protoreflect.Name = "feature_support" EnumValueOptions_UninterpretedOption_field_name protoreflect.Name = "uninterpreted_option" EnumValueOptions_Deprecated_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.deprecated" EnumValueOptions_Features_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.features" EnumValueOptions_DebugRedact_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.debug_redact" + EnumValueOptions_FeatureSupport_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.feature_support" EnumValueOptions_UninterpretedOption_field_fullname protoreflect.FullName = "google.protobuf.EnumValueOptions.uninterpreted_option" ) @@ -842,6 +875,7 @@ const ( EnumValueOptions_Deprecated_field_number protoreflect.FieldNumber = 1 EnumValueOptions_Features_field_number protoreflect.FieldNumber = 2 EnumValueOptions_DebugRedact_field_number protoreflect.FieldNumber = 3 + EnumValueOptions_FeatureSupport_field_number protoreflect.FieldNumber = 4 EnumValueOptions_UninterpretedOption_field_number protoreflect.FieldNumber = 999 ) @@ -1110,17 +1144,20 @@ const ( // Field names for google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault. const ( - FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_name protoreflect.Name = "edition" - FeatureSetDefaults_FeatureSetEditionDefault_Features_field_name protoreflect.Name = "features" + FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_name protoreflect.Name = "edition" + FeatureSetDefaults_FeatureSetEditionDefault_OverridableFeatures_field_name protoreflect.Name = "overridable_features" + FeatureSetDefaults_FeatureSetEditionDefault_FixedFeatures_field_name protoreflect.Name = "fixed_features" - FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition" - FeatureSetDefaults_FeatureSetEditionDefault_Features_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.features" + FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition" + FeatureSetDefaults_FeatureSetEditionDefault_OverridableFeatures_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.overridable_features" + FeatureSetDefaults_FeatureSetEditionDefault_FixedFeatures_field_fullname protoreflect.FullName = "google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.fixed_features" ) // Field numbers for google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault. const ( - FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_number protoreflect.FieldNumber = 3 - FeatureSetDefaults_FeatureSetEditionDefault_Features_field_number protoreflect.FieldNumber = 2 + FeatureSetDefaults_FeatureSetEditionDefault_Edition_field_number protoreflect.FieldNumber = 3 + FeatureSetDefaults_FeatureSetEditionDefault_OverridableFeatures_field_number protoreflect.FieldNumber = 4 + FeatureSetDefaults_FeatureSetEditionDefault_FixedFeatures_field_number protoreflect.FieldNumber = 5 ) // Names for google.protobuf.SourceCodeInfo. diff --git a/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go b/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go index fd9015e8..9a652a2b 100644 --- a/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go +++ b/vendor/google.golang.org/protobuf/internal/genid/go_features_gen.go @@ -10,7 +10,7 @@ import ( protoreflect "google.golang.org/protobuf/reflect/protoreflect" ) -const File_reflect_protodesc_proto_go_features_proto = "reflect/protodesc/proto/go_features.proto" +const File_google_protobuf_go_features_proto = "google/protobuf/go_features.proto" // Names for google.protobuf.GoFeatures. const ( diff --git a/vendor/google.golang.org/protobuf/internal/impl/api_export.go b/vendor/google.golang.org/protobuf/internal/impl/api_export.go index a371f98d..5d5771c2 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/api_export.go +++ b/vendor/google.golang.org/protobuf/internal/impl/api_export.go @@ -22,13 +22,13 @@ type Export struct{} // NewError formats a string according to the format specifier and arguments and // returns an error that has a "proto" prefix. -func (Export) NewError(f string, x ...interface{}) error { +func (Export) NewError(f string, x ...any) error { return errors.New(f, x...) } // enum is any enum type generated by protoc-gen-go // and must be a named int32 type. -type enum = interface{} +type enum = any // EnumOf returns the protoreflect.Enum interface over e. // It returns nil if e is nil. @@ -81,7 +81,7 @@ func (Export) EnumStringOf(ed protoreflect.EnumDescriptor, n protoreflect.EnumNu // message is any message type generated by protoc-gen-go // and must be a pointer to a named struct type. -type message = interface{} +type message = any // legacyMessageWrapper wraps a v2 message as a v1 message. type legacyMessageWrapper struct{ m protoreflect.ProtoMessage } diff --git a/vendor/google.golang.org/protobuf/internal/impl/checkinit.go b/vendor/google.golang.org/protobuf/internal/impl/checkinit.go index bff041ed..f29e6a8f 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/checkinit.go +++ b/vendor/google.golang.org/protobuf/internal/impl/checkinit.go @@ -68,7 +68,7 @@ func (mi *MessageInfo) isInitExtensions(ext *map[int32]ExtensionField) error { } for _, x := range *ext { ei := getExtensionFieldInfo(x.Type()) - if ei.funcs.isInit == nil { + if ei.funcs.isInit == nil || x.isUnexpandedLazy() { continue } v := x.Value() diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go b/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go index 2b8f122c..4bb0a7a2 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go @@ -99,6 +99,28 @@ func (f *ExtensionField) canLazy(xt protoreflect.ExtensionType) bool { return false } +// isUnexpandedLazy returns true if the ExensionField is lazy and not +// yet expanded, which means it's present and already checked for +// initialized required fields. +func (f *ExtensionField) isUnexpandedLazy() bool { + return f.lazy != nil && atomic.LoadUint32(&f.lazy.atomicOnce) == 0 +} + +// lazyBuffer retrieves the buffer for a lazy extension if it's not yet expanded. +// +// The returned buffer has to be kept over whatever operation we're planning, +// as re-retrieving it will fail after the message is lazily decoded. +func (f *ExtensionField) lazyBuffer() []byte { + // This function might be in the critical path, so check the atomic without + // taking a look first, then only take the lock if needed. + if !f.isUnexpandedLazy() { + return nil + } + f.lazy.mu.Lock() + defer f.lazy.mu.Unlock() + return f.lazy.b +} + func (f *ExtensionField) lazyInit() { f.lazy.mu.Lock() defer f.lazy.mu.Unlock() diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_field.go b/vendor/google.golang.org/protobuf/internal/impl/codec_field.go index 3fadd241..78ee47e4 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_field.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_field.go @@ -233,9 +233,15 @@ func sizeMessageInfo(p pointer, f *coderFieldInfo, opts marshalOptions) int { } func appendMessageInfo(b []byte, p pointer, f *coderFieldInfo, opts marshalOptions) ([]byte, error) { + calculatedSize := f.mi.sizePointer(p.Elem(), opts) b = protowire.AppendVarint(b, f.wiretag) - b = protowire.AppendVarint(b, uint64(f.mi.sizePointer(p.Elem(), opts))) - return f.mi.marshalAppendPointer(b, p.Elem(), opts) + b = protowire.AppendVarint(b, uint64(calculatedSize)) + before := len(b) + b, err := f.mi.marshalAppendPointer(b, p.Elem(), opts) + if measuredSize := len(b) - before; calculatedSize != measuredSize && err == nil { + return nil, errors.MismatchedSizeCalculation(calculatedSize, measuredSize) + } + return b, err } func consumeMessageInfo(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { @@ -262,14 +268,21 @@ func isInitMessageInfo(p pointer, f *coderFieldInfo) error { return f.mi.checkInitializedPointer(p.Elem()) } -func sizeMessage(m proto.Message, tagsize int, _ marshalOptions) int { - return protowire.SizeBytes(proto.Size(m)) + tagsize +func sizeMessage(m proto.Message, tagsize int, opts marshalOptions) int { + return protowire.SizeBytes(opts.Options().Size(m)) + tagsize } func appendMessage(b []byte, m proto.Message, wiretag uint64, opts marshalOptions) ([]byte, error) { + mopts := opts.Options() + calculatedSize := mopts.Size(m) b = protowire.AppendVarint(b, wiretag) - b = protowire.AppendVarint(b, uint64(proto.Size(m))) - return opts.Options().MarshalAppend(b, m) + b = protowire.AppendVarint(b, uint64(calculatedSize)) + before := len(b) + b, err := mopts.MarshalAppend(b, m) + if measuredSize := len(b) - before; calculatedSize != measuredSize && err == nil { + return nil, errors.MismatchedSizeCalculation(calculatedSize, measuredSize) + } + return b, err } func consumeMessage(b []byte, m proto.Message, wtyp protowire.Type, opts unmarshalOptions) (out unmarshalOutput, err error) { @@ -405,8 +418,8 @@ func consumeGroupType(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInf return f.mi.unmarshalPointer(b, p.Elem(), f.num, opts) } -func sizeGroup(m proto.Message, tagsize int, _ marshalOptions) int { - return 2*tagsize + proto.Size(m) +func sizeGroup(m proto.Message, tagsize int, opts marshalOptions) int { + return 2*tagsize + opts.Options().Size(m) } func appendGroup(b []byte, m proto.Message, wiretag uint64, opts marshalOptions) ([]byte, error) { @@ -482,10 +495,14 @@ func appendMessageSliceInfo(b []byte, p pointer, f *coderFieldInfo, opts marshal b = protowire.AppendVarint(b, f.wiretag) siz := f.mi.sizePointer(v, opts) b = protowire.AppendVarint(b, uint64(siz)) + before := len(b) b, err = f.mi.marshalAppendPointer(b, v, opts) if err != nil { return b, err } + if measuredSize := len(b) - before; siz != measuredSize { + return nil, errors.MismatchedSizeCalculation(siz, measuredSize) + } } return b, nil } @@ -520,28 +537,34 @@ func isInitMessageSliceInfo(p pointer, f *coderFieldInfo) error { return nil } -func sizeMessageSlice(p pointer, goType reflect.Type, tagsize int, _ marshalOptions) int { +func sizeMessageSlice(p pointer, goType reflect.Type, tagsize int, opts marshalOptions) int { + mopts := opts.Options() s := p.PointerSlice() n := 0 for _, v := range s { m := asMessage(v.AsValueOf(goType.Elem())) - n += protowire.SizeBytes(proto.Size(m)) + tagsize + n += protowire.SizeBytes(mopts.Size(m)) + tagsize } return n } func appendMessageSlice(b []byte, p pointer, wiretag uint64, goType reflect.Type, opts marshalOptions) ([]byte, error) { + mopts := opts.Options() s := p.PointerSlice() var err error for _, v := range s { m := asMessage(v.AsValueOf(goType.Elem())) b = protowire.AppendVarint(b, wiretag) - siz := proto.Size(m) + siz := mopts.Size(m) b = protowire.AppendVarint(b, uint64(siz)) - b, err = opts.Options().MarshalAppend(b, m) + before := len(b) + b, err = mopts.MarshalAppend(b, m) if err != nil { return b, err } + if measuredSize := len(b) - before; siz != measuredSize { + return nil, errors.MismatchedSizeCalculation(siz, measuredSize) + } } return b, nil } @@ -582,11 +605,12 @@ func isInitMessageSlice(p pointer, goType reflect.Type) error { // Slices of messages func sizeMessageSliceValue(listv protoreflect.Value, tagsize int, opts marshalOptions) int { + mopts := opts.Options() list := listv.List() n := 0 for i, llen := 0, list.Len(); i < llen; i++ { m := list.Get(i).Message().Interface() - n += protowire.SizeBytes(proto.Size(m)) + tagsize + n += protowire.SizeBytes(mopts.Size(m)) + tagsize } return n } @@ -597,13 +621,17 @@ func appendMessageSliceValue(b []byte, listv protoreflect.Value, wiretag uint64, for i, llen := 0, list.Len(); i < llen; i++ { m := list.Get(i).Message().Interface() b = protowire.AppendVarint(b, wiretag) - siz := proto.Size(m) + siz := mopts.Size(m) b = protowire.AppendVarint(b, uint64(siz)) + before := len(b) var err error b, err = mopts.MarshalAppend(b, m) if err != nil { return b, err } + if measuredSize := len(b) - before; siz != measuredSize { + return nil, errors.MismatchedSizeCalculation(siz, measuredSize) + } } return b, nil } @@ -651,11 +679,12 @@ var coderMessageSliceValue = valueCoderFuncs{ } func sizeGroupSliceValue(listv protoreflect.Value, tagsize int, opts marshalOptions) int { + mopts := opts.Options() list := listv.List() n := 0 for i, llen := 0, list.Len(); i < llen; i++ { m := list.Get(i).Message().Interface() - n += 2*tagsize + proto.Size(m) + n += 2*tagsize + mopts.Size(m) } return n } @@ -738,12 +767,13 @@ func makeGroupSliceFieldCoder(fd protoreflect.FieldDescriptor, ft reflect.Type) } } -func sizeGroupSlice(p pointer, messageType reflect.Type, tagsize int, _ marshalOptions) int { +func sizeGroupSlice(p pointer, messageType reflect.Type, tagsize int, opts marshalOptions) int { + mopts := opts.Options() s := p.PointerSlice() n := 0 for _, v := range s { m := asMessage(v.AsValueOf(messageType.Elem())) - n += 2*tagsize + proto.Size(m) + n += 2*tagsize + mopts.Size(m) } return n } diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_map.go b/vendor/google.golang.org/protobuf/internal/impl/codec_map.go index 111b9d16..fb35f0ba 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_map.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_map.go @@ -9,6 +9,7 @@ import ( "sort" "google.golang.org/protobuf/encoding/protowire" + "google.golang.org/protobuf/internal/errors" "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/reflect/protoreflect" ) @@ -240,11 +241,16 @@ func appendMapItem(b []byte, keyrv, valrv reflect.Value, mapi *mapInfo, f *coder size += mapi.keyFuncs.size(key.Value(), mapKeyTagSize, opts) size += mapi.valFuncs.size(val, mapValTagSize, opts) b = protowire.AppendVarint(b, uint64(size)) + before := len(b) b, err := mapi.keyFuncs.marshal(b, key.Value(), mapi.keyWiretag, opts) if err != nil { return nil, err } - return mapi.valFuncs.marshal(b, val, mapi.valWiretag, opts) + b, err = mapi.valFuncs.marshal(b, val, mapi.valWiretag, opts) + if measuredSize := len(b) - before; size != measuredSize && err == nil { + return nil, errors.MismatchedSizeCalculation(size, measuredSize) + } + return b, err } else { key := mapi.conv.keyConv.PBValueOf(keyrv).MapKey() val := pointerOfValue(valrv) @@ -259,7 +265,12 @@ func appendMapItem(b []byte, keyrv, valrv reflect.Value, mapi *mapInfo, f *coder } b = protowire.AppendVarint(b, mapi.valWiretag) b = protowire.AppendVarint(b, uint64(valSize)) - return f.mi.marshalAppendPointer(b, val, opts) + before := len(b) + b, err = f.mi.marshalAppendPointer(b, val, opts) + if measuredSize := len(b) - before; valSize != measuredSize && err == nil { + return nil, errors.MismatchedSizeCalculation(valSize, measuredSize) + } + return b, err } } diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_messageset.go b/vendor/google.golang.org/protobuf/internal/impl/codec_messageset.go index b7a23faf..7a16ec13 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_messageset.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_messageset.go @@ -26,6 +26,15 @@ func sizeMessageSet(mi *MessageInfo, p pointer, opts marshalOptions) (size int) } num, _ := protowire.DecodeTag(xi.wiretag) size += messageset.SizeField(num) + if fullyLazyExtensions(opts) { + // Don't expand the extension, instead use the buffer to calculate size + if lb := x.lazyBuffer(); lb != nil { + // We got hold of the buffer, so it's still lazy. + // Don't count the tag size in the extension buffer, it's already added. + size += protowire.SizeTag(messageset.FieldMessage) + len(lb) - xi.tagsize + continue + } + } size += xi.funcs.size(x.Value(), protowire.SizeTag(messageset.FieldMessage), opts) } @@ -85,6 +94,19 @@ func marshalMessageSetField(mi *MessageInfo, b []byte, x ExtensionField, opts ma xi := getExtensionFieldInfo(x.Type()) num, _ := protowire.DecodeTag(xi.wiretag) b = messageset.AppendFieldStart(b, num) + + if fullyLazyExtensions(opts) { + // Don't expand the extension if it's still in wire format, instead use the buffer content. + if lb := x.lazyBuffer(); lb != nil { + // The tag inside the lazy buffer is a different tag (the extension + // number), but what we need here is the tag for FieldMessage: + b = protowire.AppendVarint(b, protowire.EncodeTag(messageset.FieldMessage, protowire.BytesType)) + b = append(b, lb[xi.tagsize:]...) + b = messageset.AppendFieldEnd(b) + return b, nil + } + } + b, err := xi.funcs.marshal(b, x.Value(), protowire.EncodeTag(messageset.FieldMessage, protowire.BytesType), opts) if err != nil { return b, err diff --git a/vendor/google.golang.org/protobuf/internal/impl/convert.go b/vendor/google.golang.org/protobuf/internal/impl/convert.go index 185ef2ef..e06ece55 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/convert.go +++ b/vendor/google.golang.org/protobuf/internal/impl/convert.go @@ -14,7 +14,7 @@ import ( // unwrapper unwraps the value to the underlying value. // This is implemented by List and Map. type unwrapper interface { - protoUnwrap() interface{} + protoUnwrap() any } // A Converter coverts to/from Go reflect.Value types and protobuf protoreflect.Value types. diff --git a/vendor/google.golang.org/protobuf/internal/impl/convert_list.go b/vendor/google.golang.org/protobuf/internal/impl/convert_list.go index f8913651..18cb96fd 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/convert_list.go +++ b/vendor/google.golang.org/protobuf/internal/impl/convert_list.go @@ -136,6 +136,6 @@ func (ls *listReflect) NewElement() protoreflect.Value { func (ls *listReflect) IsValid() bool { return !ls.v.IsNil() } -func (ls *listReflect) protoUnwrap() interface{} { +func (ls *listReflect) protoUnwrap() any { return ls.v.Interface() } diff --git a/vendor/google.golang.org/protobuf/internal/impl/convert_map.go b/vendor/google.golang.org/protobuf/internal/impl/convert_map.go index f30b0a05..304244a6 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/convert_map.go +++ b/vendor/google.golang.org/protobuf/internal/impl/convert_map.go @@ -116,6 +116,6 @@ func (ms *mapReflect) NewValue() protoreflect.Value { func (ms *mapReflect) IsValid() bool { return !ms.v.IsNil() } -func (ms *mapReflect) protoUnwrap() interface{} { +func (ms *mapReflect) protoUnwrap() any { return ms.v.Interface() } diff --git a/vendor/google.golang.org/protobuf/internal/impl/encode.go b/vendor/google.golang.org/protobuf/internal/impl/encode.go index 845c67d6..febd2122 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/encode.go +++ b/vendor/google.golang.org/protobuf/internal/impl/encode.go @@ -49,8 +49,11 @@ func (mi *MessageInfo) sizePointer(p pointer, opts marshalOptions) (size int) { return 0 } if opts.UseCachedSize() && mi.sizecacheOffset.IsValid() { - if size := atomic.LoadInt32(p.Apply(mi.sizecacheOffset).Int32()); size >= 0 { - return int(size) + // The size cache contains the size + 1, to allow the + // zero value to be invalid, while also allowing for a + // 0 size to be cached. + if size := atomic.LoadInt32(p.Apply(mi.sizecacheOffset).Int32()); size > 0 { + return int(size - 1) } } return mi.sizePointerSlow(p, opts) @@ -60,7 +63,7 @@ func (mi *MessageInfo) sizePointerSlow(p pointer, opts marshalOptions) (size int if flags.ProtoLegacy && mi.isMessageSet { size = sizeMessageSet(mi, p, opts) if mi.sizecacheOffset.IsValid() { - atomic.StoreInt32(p.Apply(mi.sizecacheOffset).Int32(), int32(size)) + atomic.StoreInt32(p.Apply(mi.sizecacheOffset).Int32(), int32(size+1)) } return size } @@ -84,13 +87,16 @@ func (mi *MessageInfo) sizePointerSlow(p pointer, opts marshalOptions) (size int } } if mi.sizecacheOffset.IsValid() { - if size > math.MaxInt32 { + if size > (math.MaxInt32 - 1) { // The size is too large for the int32 sizecache field. // We will need to recompute the size when encoding; // unfortunately expensive, but better than invalid output. - atomic.StoreInt32(p.Apply(mi.sizecacheOffset).Int32(), -1) + atomic.StoreInt32(p.Apply(mi.sizecacheOffset).Int32(), 0) } else { - atomic.StoreInt32(p.Apply(mi.sizecacheOffset).Int32(), int32(size)) + // The size cache contains the size + 1, to allow the + // zero value to be invalid, while also allowing for a + // 0 size to be cached. + atomic.StoreInt32(p.Apply(mi.sizecacheOffset).Int32(), int32(size+1)) } } return size @@ -149,6 +155,14 @@ func (mi *MessageInfo) marshalAppendPointer(b []byte, p pointer, opts marshalOpt return b, nil } +// fullyLazyExtensions returns true if we should attempt to keep extensions lazy over size and marshal. +func fullyLazyExtensions(opts marshalOptions) bool { + // When deterministic marshaling is requested, force an unmarshal for lazy + // extensions to produce a deterministic result, instead of passing through + // bytes lazily that may or may not match what Go Protobuf would produce. + return opts.flags&piface.MarshalDeterministic == 0 +} + func (mi *MessageInfo) sizeExtensions(ext *map[int32]ExtensionField, opts marshalOptions) (n int) { if ext == nil { return 0 @@ -158,6 +172,14 @@ func (mi *MessageInfo) sizeExtensions(ext *map[int32]ExtensionField, opts marsha if xi.funcs.size == nil { continue } + if fullyLazyExtensions(opts) { + // Don't expand the extension, instead use the buffer to calculate size + if lb := x.lazyBuffer(); lb != nil { + // We got hold of the buffer, so it's still lazy. + n += len(lb) + continue + } + } n += xi.funcs.size(x.Value(), xi.tagsize, opts) } return n @@ -176,6 +198,13 @@ func (mi *MessageInfo) appendExtensions(b []byte, ext *map[int32]ExtensionField, var err error for _, x := range *ext { xi := getExtensionFieldInfo(x.Type()) + if fullyLazyExtensions(opts) { + // Don't expand the extension if it's still in wire format, instead use the buffer content. + if lb := x.lazyBuffer(); lb != nil { + b = append(b, lb...) + continue + } + } b, err = xi.funcs.marshal(b, x.Value(), xi.wiretag, opts) } return b, err @@ -191,6 +220,13 @@ func (mi *MessageInfo) appendExtensions(b []byte, ext *map[int32]ExtensionField, for _, k := range keys { x := (*ext)[int32(k)] xi := getExtensionFieldInfo(x.Type()) + if fullyLazyExtensions(opts) { + // Don't expand the extension if it's still in wire format, instead use the buffer content. + if lb := x.lazyBuffer(); lb != nil { + b = append(b, lb...) + continue + } + } b, err = xi.funcs.marshal(b, x.Value(), xi.wiretag, opts) if err != nil { return b, err diff --git a/vendor/google.golang.org/protobuf/internal/impl/extension.go b/vendor/google.golang.org/protobuf/internal/impl/extension.go index cb25b0ba..e31249f6 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/extension.go +++ b/vendor/google.golang.org/protobuf/internal/impl/extension.go @@ -53,7 +53,7 @@ type ExtensionInfo struct { // type returned by InterfaceOf may not be identical. // // Deprecated: Use InterfaceOf(xt.Zero()) instead. - ExtensionType interface{} + ExtensionType any // Field is the field number of the extension. // @@ -95,16 +95,16 @@ func (xi *ExtensionInfo) New() protoreflect.Value { func (xi *ExtensionInfo) Zero() protoreflect.Value { return xi.lazyInit().Zero() } -func (xi *ExtensionInfo) ValueOf(v interface{}) protoreflect.Value { +func (xi *ExtensionInfo) ValueOf(v any) protoreflect.Value { return xi.lazyInit().PBValueOf(reflect.ValueOf(v)) } -func (xi *ExtensionInfo) InterfaceOf(v protoreflect.Value) interface{} { +func (xi *ExtensionInfo) InterfaceOf(v protoreflect.Value) any { return xi.lazyInit().GoValueOf(v).Interface() } func (xi *ExtensionInfo) IsValidValue(v protoreflect.Value) bool { return xi.lazyInit().IsValidPB(v) } -func (xi *ExtensionInfo) IsValidInterface(v interface{}) bool { +func (xi *ExtensionInfo) IsValidInterface(v any) bool { return xi.lazyInit().IsValidGo(reflect.ValueOf(v)) } func (xi *ExtensionInfo) TypeDescriptor() protoreflect.ExtensionTypeDescriptor { diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_enum.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_enum.go index c2a803bb..81b2b1a7 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_enum.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_enum.go @@ -97,7 +97,7 @@ func (e *legacyEnumWrapper) Number() protoreflect.EnumNumber { func (e *legacyEnumWrapper) ProtoReflect() protoreflect.Enum { return e } -func (e *legacyEnumWrapper) protoUnwrap() interface{} { +func (e *legacyEnumWrapper) protoUnwrap() any { v := reflect.New(e.goTyp).Elem() v.SetInt(int64(e.num)) return v.Interface() @@ -167,6 +167,7 @@ func aberrantLoadEnumDesc(t reflect.Type) protoreflect.EnumDescriptor { ed := &filedesc.Enum{L2: new(filedesc.EnumL2)} ed.L0.FullName = AberrantDeriveFullName(t) // e.g., github_com.user.repo.MyEnum ed.L0.ParentFile = filedesc.SurrogateProto3 + ed.L1.EditionFeatures = ed.L0.ParentFile.L1.EditionFeatures ed.L2.Values.List = append(ed.L2.Values.List, filedesc.EnumValue{}) // TODO: Use the presence of a UnmarshalJSON method to determine proto2? diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_extension.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_extension.go index 87b30d05..6e8677ee 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_extension.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_extension.go @@ -118,7 +118,7 @@ func (xi *ExtensionInfo) initFromLegacy() { xd.L1.Number = protoreflect.FieldNumber(xi.Field) xd.L1.Cardinality = fd.L1.Cardinality xd.L1.Kind = fd.L1.Kind - xd.L2.IsPacked = fd.L1.IsPacked + xd.L1.EditionFeatures = fd.L1.EditionFeatures xd.L2.Default = fd.L1.Default xd.L1.Extendee = Export{}.MessageDescriptorOf(xi.ExtendedType) xd.L2.Enum = ed diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_file.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_file.go index 9ab09108..b649f112 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_file.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_file.go @@ -7,7 +7,7 @@ package impl import ( "bytes" "compress/gzip" - "io/ioutil" + "io" "sync" "google.golang.org/protobuf/internal/filedesc" @@ -51,7 +51,7 @@ func legacyLoadFileDesc(b []byte) protoreflect.FileDescriptor { if err != nil { panic(err) } - b2, err := ioutil.ReadAll(zr) + b2, err := io.ReadAll(zr) if err != nil { panic(err) } diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go index 2ab2c629..bf0b6049 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go @@ -204,6 +204,7 @@ func aberrantLoadMessageDescReentrant(t reflect.Type, name protoreflect.FullName } } + md.L1.EditionFeatures = md.L0.ParentFile.L1.EditionFeatures // Obtain a list of oneof wrapper types. var oneofWrappers []reflect.Type methods := make([]reflect.Method, 0, 2) @@ -215,7 +216,7 @@ func aberrantLoadMessageDescReentrant(t reflect.Type, name protoreflect.FullName } for _, fn := range methods { for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) { - if vs, ok := v.Interface().([]interface{}); ok { + if vs, ok := v.Interface().([]any); ok { for _, v := range vs { oneofWrappers = append(oneofWrappers, reflect.TypeOf(v)) } @@ -250,6 +251,7 @@ func aberrantLoadMessageDescReentrant(t reflect.Type, name protoreflect.FullName od := &md.L2.Oneofs.List[n] od.L0.FullName = md.FullName().Append(protoreflect.Name(tag)) od.L0.ParentFile = md.L0.ParentFile + od.L1.EditionFeatures = md.L1.EditionFeatures od.L0.Parent = md od.L0.Index = n @@ -260,6 +262,7 @@ func aberrantLoadMessageDescReentrant(t reflect.Type, name protoreflect.FullName aberrantAppendField(md, f.Type, tag, "", "") fd := &md.L2.Fields.List[len(md.L2.Fields.List)-1] fd.L1.ContainingOneof = od + fd.L1.EditionFeatures = od.L1.EditionFeatures od.L1.Fields.List = append(od.L1.Fields.List, fd) } } @@ -307,14 +310,14 @@ func aberrantAppendField(md *filedesc.Message, goType reflect.Type, tag, tagKey, fd.L0.Parent = md fd.L0.Index = n - if fd.L1.IsWeak || fd.L1.HasPacked { + if fd.L1.IsWeak || fd.L1.EditionFeatures.IsPacked { fd.L1.Options = func() protoreflect.ProtoMessage { opts := descopts.Field.ProtoReflect().New() if fd.L1.IsWeak { opts.Set(opts.Descriptor().Fields().ByName("weak"), protoreflect.ValueOfBool(true)) } - if fd.L1.HasPacked { - opts.Set(opts.Descriptor().Fields().ByName("packed"), protoreflect.ValueOfBool(fd.L1.IsPacked)) + if fd.L1.EditionFeatures.IsPacked { + opts.Set(opts.Descriptor().Fields().ByName("packed"), protoreflect.ValueOfBool(fd.L1.EditionFeatures.IsPacked)) } return opts.Interface() } @@ -344,6 +347,7 @@ func aberrantAppendField(md *filedesc.Message, goType reflect.Type, tag, tagKey, md2.L0.ParentFile = md.L0.ParentFile md2.L0.Parent = md md2.L0.Index = n + md2.L1.EditionFeatures = md.L1.EditionFeatures md2.L1.IsMapEntry = true md2.L2.Options = func() protoreflect.ProtoMessage { @@ -563,6 +567,6 @@ func (m aberrantMessage) IsValid() bool { func (m aberrantMessage) ProtoMethods() *protoiface.Methods { return aberrantProtoMethods } -func (m aberrantMessage) protoUnwrap() interface{} { +func (m aberrantMessage) protoUnwrap() any { return m.v.Interface() } diff --git a/vendor/google.golang.org/protobuf/internal/impl/message.go b/vendor/google.golang.org/protobuf/internal/impl/message.go index 629bacdc..019399d4 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message.go @@ -35,7 +35,7 @@ type MessageInfo struct { Exporter exporter // OneofWrappers is list of pointers to oneof wrapper struct types. - OneofWrappers []interface{} + OneofWrappers []any initMu sync.Mutex // protects all unexported fields initDone uint32 @@ -47,7 +47,7 @@ type MessageInfo struct { // exporter is a function that returns a reference to the ith field of v, // where v is a pointer to a struct. It returns nil if it does not support // exporting the requested field (e.g., already exported). -type exporter func(v interface{}, i int) interface{} +type exporter func(v any, i int) any // getMessageInfo returns the MessageInfo for any message type that // is generated by our implementation of protoc-gen-go (for v2 and on). @@ -201,7 +201,7 @@ fieldLoop: } for _, fn := range methods { for _, v := range fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))}) { - if vs, ok := v.Interface().([]interface{}); ok { + if vs, ok := v.Interface().([]any); ok { oneofWrappers = vs } } @@ -256,7 +256,7 @@ func (mi *MessageInfo) Message(i int) protoreflect.MessageType { type mapEntryType struct { desc protoreflect.MessageDescriptor - valType interface{} // zero value of enum or message type + valType any // zero value of enum or message type } func (mt mapEntryType) New() protoreflect.Message { diff --git a/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go b/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go index d9ea010b..ecb4623d 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go @@ -20,7 +20,7 @@ type reflectMessageInfo struct { // fieldTypes contains the zero value of an enum or message field. // For lists, it contains the element type. // For maps, it contains the entry value type. - fieldTypes map[protoreflect.FieldNumber]interface{} + fieldTypes map[protoreflect.FieldNumber]any // denseFields is a subset of fields where: // 0 < fieldDesc.Number() < len(denseFields) @@ -28,7 +28,7 @@ type reflectMessageInfo struct { denseFields []*fieldInfo // rangeInfos is a list of all fields (not belonging to a oneof) and oneofs. - rangeInfos []interface{} // either *fieldInfo or *oneofInfo + rangeInfos []any // either *fieldInfo or *oneofInfo getUnknown func(pointer) protoreflect.RawFields setUnknown func(pointer, protoreflect.RawFields) @@ -224,7 +224,7 @@ func (mi *MessageInfo) makeFieldTypes(si structInfo) { } if ft != nil { if mi.fieldTypes == nil { - mi.fieldTypes = make(map[protoreflect.FieldNumber]interface{}) + mi.fieldTypes = make(map[protoreflect.FieldNumber]any) } mi.fieldTypes[fd.Number()] = reflect.Zero(ft).Interface() } @@ -247,39 +247,39 @@ func (m *extensionMap) Range(f func(protoreflect.FieldDescriptor, protoreflect.V } } } -func (m *extensionMap) Has(xt protoreflect.ExtensionType) (ok bool) { +func (m *extensionMap) Has(xd protoreflect.ExtensionTypeDescriptor) (ok bool) { if m == nil { return false } - xd := xt.TypeDescriptor() x, ok := (*m)[int32(xd.Number())] if !ok { return false } + if x.isUnexpandedLazy() { + // Avoid calling x.Value(), which triggers a lazy unmarshal. + return true + } switch { case xd.IsList(): return x.Value().List().Len() > 0 case xd.IsMap(): return x.Value().Map().Len() > 0 - case xd.Message() != nil: - return x.Value().Message().IsValid() } return true } -func (m *extensionMap) Clear(xt protoreflect.ExtensionType) { - delete(*m, int32(xt.TypeDescriptor().Number())) +func (m *extensionMap) Clear(xd protoreflect.ExtensionTypeDescriptor) { + delete(*m, int32(xd.Number())) } -func (m *extensionMap) Get(xt protoreflect.ExtensionType) protoreflect.Value { - xd := xt.TypeDescriptor() +func (m *extensionMap) Get(xd protoreflect.ExtensionTypeDescriptor) protoreflect.Value { if m != nil { if x, ok := (*m)[int32(xd.Number())]; ok { return x.Value() } } - return xt.Zero() + return xd.Type().Zero() } -func (m *extensionMap) Set(xt protoreflect.ExtensionType, v protoreflect.Value) { - xd := xt.TypeDescriptor() +func (m *extensionMap) Set(xd protoreflect.ExtensionTypeDescriptor, v protoreflect.Value) { + xt := xd.Type() isValid := true switch { case !xt.IsValidValue(v): @@ -292,7 +292,7 @@ func (m *extensionMap) Set(xt protoreflect.ExtensionType, v protoreflect.Value) isValid = v.Message().IsValid() } if !isValid { - panic(fmt.Sprintf("%v: assigning invalid value", xt.TypeDescriptor().FullName())) + panic(fmt.Sprintf("%v: assigning invalid value", xd.FullName())) } if *m == nil { @@ -302,16 +302,15 @@ func (m *extensionMap) Set(xt protoreflect.ExtensionType, v protoreflect.Value) x.Set(xt, v) (*m)[int32(xd.Number())] = x } -func (m *extensionMap) Mutable(xt protoreflect.ExtensionType) protoreflect.Value { - xd := xt.TypeDescriptor() +func (m *extensionMap) Mutable(xd protoreflect.ExtensionTypeDescriptor) protoreflect.Value { if xd.Kind() != protoreflect.MessageKind && xd.Kind() != protoreflect.GroupKind && !xd.IsList() && !xd.IsMap() { panic("invalid Mutable on field with non-composite type") } if x, ok := (*m)[int32(xd.Number())]; ok { return x.Value() } - v := xt.New() - m.Set(xt, v) + v := xd.Type().New() + m.Set(xd, v) return v } @@ -394,7 +393,7 @@ var ( // MessageOf returns a reflective view over a message. The input must be a // pointer to a named Go struct. If the provided type has a ProtoReflect method, // it must be implemented by calling this method. -func (mi *MessageInfo) MessageOf(m interface{}) protoreflect.Message { +func (mi *MessageInfo) MessageOf(m any) protoreflect.Message { if reflect.TypeOf(m) != mi.GoReflectType { panic(fmt.Sprintf("type mismatch: got %T, want %v", m, mi.GoReflectType)) } @@ -422,13 +421,13 @@ func (m *messageIfaceWrapper) Reset() { func (m *messageIfaceWrapper) ProtoReflect() protoreflect.Message { return (*messageReflectWrapper)(m) } -func (m *messageIfaceWrapper) protoUnwrap() interface{} { +func (m *messageIfaceWrapper) protoUnwrap() any { return m.p.AsIfaceOf(m.mi.GoReflectType.Elem()) } // checkField verifies that the provided field descriptor is valid. // Exactly one of the returned values is populated. -func (mi *MessageInfo) checkField(fd protoreflect.FieldDescriptor) (*fieldInfo, protoreflect.ExtensionType) { +func (mi *MessageInfo) checkField(fd protoreflect.FieldDescriptor) (*fieldInfo, protoreflect.ExtensionTypeDescriptor) { var fi *fieldInfo if n := fd.Number(); 0 < n && int(n) < len(mi.denseFields) { fi = mi.denseFields[n] @@ -457,7 +456,7 @@ func (mi *MessageInfo) checkField(fd protoreflect.FieldDescriptor) (*fieldInfo, if !ok { panic(fmt.Sprintf("extension %v does not implement protoreflect.ExtensionTypeDescriptor", fd.FullName())) } - return nil, xtd.Type() + return nil, xtd } panic(fmt.Sprintf("field %v is invalid", fd.FullName())) } diff --git a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_gen.go b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_gen.go index 741d6e5b..99dc23c6 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_gen.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_gen.go @@ -23,12 +23,13 @@ func (m *messageState) New() protoreflect.Message { func (m *messageState) Interface() protoreflect.ProtoMessage { return m.protoUnwrap().(protoreflect.ProtoMessage) } -func (m *messageState) protoUnwrap() interface{} { +func (m *messageState) protoUnwrap() any { return m.pointer().AsIfaceOf(m.messageInfo().GoReflectType.Elem()) } func (m *messageState) ProtoMethods() *protoiface.Methods { - m.messageInfo().init() - return &m.messageInfo().methods + mi := m.messageInfo() + mi.init() + return &mi.methods } // ProtoMessageInfo is a pseudo-internal API for allowing the v1 code @@ -41,8 +42,9 @@ func (m *messageState) ProtoMessageInfo() *MessageInfo { } func (m *messageState) Range(f func(protoreflect.FieldDescriptor, protoreflect.Value) bool) { - m.messageInfo().init() - for _, ri := range m.messageInfo().rangeInfos { + mi := m.messageInfo() + mi.init() + for _, ri := range mi.rangeInfos { switch ri := ri.(type) { case *fieldInfo: if ri.has(m.pointer()) { @@ -52,77 +54,86 @@ func (m *messageState) Range(f func(protoreflect.FieldDescriptor, protoreflect.V } case *oneofInfo: if n := ri.which(m.pointer()); n > 0 { - fi := m.messageInfo().fields[n] + fi := mi.fields[n] if !f(fi.fieldDesc, fi.get(m.pointer())) { return } } } } - m.messageInfo().extensionMap(m.pointer()).Range(f) + mi.extensionMap(m.pointer()).Range(f) } func (m *messageState) Has(fd protoreflect.FieldDescriptor) bool { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { return fi.has(m.pointer()) } else { - return m.messageInfo().extensionMap(m.pointer()).Has(xt) + return mi.extensionMap(m.pointer()).Has(xd) } } func (m *messageState) Clear(fd protoreflect.FieldDescriptor) { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { fi.clear(m.pointer()) } else { - m.messageInfo().extensionMap(m.pointer()).Clear(xt) + mi.extensionMap(m.pointer()).Clear(xd) } } func (m *messageState) Get(fd protoreflect.FieldDescriptor) protoreflect.Value { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { return fi.get(m.pointer()) } else { - return m.messageInfo().extensionMap(m.pointer()).Get(xt) + return mi.extensionMap(m.pointer()).Get(xd) } } func (m *messageState) Set(fd protoreflect.FieldDescriptor, v protoreflect.Value) { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { fi.set(m.pointer(), v) } else { - m.messageInfo().extensionMap(m.pointer()).Set(xt, v) + mi.extensionMap(m.pointer()).Set(xd, v) } } func (m *messageState) Mutable(fd protoreflect.FieldDescriptor) protoreflect.Value { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { return fi.mutable(m.pointer()) } else { - return m.messageInfo().extensionMap(m.pointer()).Mutable(xt) + return mi.extensionMap(m.pointer()).Mutable(xd) } } func (m *messageState) NewField(fd protoreflect.FieldDescriptor) protoreflect.Value { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { return fi.newField() } else { - return xt.New() + return xd.Type().New() } } func (m *messageState) WhichOneof(od protoreflect.OneofDescriptor) protoreflect.FieldDescriptor { - m.messageInfo().init() - if oi := m.messageInfo().oneofs[od.Name()]; oi != nil && oi.oneofDesc == od { + mi := m.messageInfo() + mi.init() + if oi := mi.oneofs[od.Name()]; oi != nil && oi.oneofDesc == od { return od.Fields().ByNumber(oi.which(m.pointer())) } panic("invalid oneof descriptor " + string(od.FullName()) + " for message " + string(m.Descriptor().FullName())) } func (m *messageState) GetUnknown() protoreflect.RawFields { - m.messageInfo().init() - return m.messageInfo().getUnknown(m.pointer()) + mi := m.messageInfo() + mi.init() + return mi.getUnknown(m.pointer()) } func (m *messageState) SetUnknown(b protoreflect.RawFields) { - m.messageInfo().init() - m.messageInfo().setUnknown(m.pointer(), b) + mi := m.messageInfo() + mi.init() + mi.setUnknown(m.pointer(), b) } func (m *messageState) IsValid() bool { return !m.pointer().IsNil() @@ -143,12 +154,13 @@ func (m *messageReflectWrapper) Interface() protoreflect.ProtoMessage { } return (*messageIfaceWrapper)(m) } -func (m *messageReflectWrapper) protoUnwrap() interface{} { +func (m *messageReflectWrapper) protoUnwrap() any { return m.pointer().AsIfaceOf(m.messageInfo().GoReflectType.Elem()) } func (m *messageReflectWrapper) ProtoMethods() *protoiface.Methods { - m.messageInfo().init() - return &m.messageInfo().methods + mi := m.messageInfo() + mi.init() + return &mi.methods } // ProtoMessageInfo is a pseudo-internal API for allowing the v1 code @@ -161,8 +173,9 @@ func (m *messageReflectWrapper) ProtoMessageInfo() *MessageInfo { } func (m *messageReflectWrapper) Range(f func(protoreflect.FieldDescriptor, protoreflect.Value) bool) { - m.messageInfo().init() - for _, ri := range m.messageInfo().rangeInfos { + mi := m.messageInfo() + mi.init() + for _, ri := range mi.rangeInfos { switch ri := ri.(type) { case *fieldInfo: if ri.has(m.pointer()) { @@ -172,77 +185,86 @@ func (m *messageReflectWrapper) Range(f func(protoreflect.FieldDescriptor, proto } case *oneofInfo: if n := ri.which(m.pointer()); n > 0 { - fi := m.messageInfo().fields[n] + fi := mi.fields[n] if !f(fi.fieldDesc, fi.get(m.pointer())) { return } } } } - m.messageInfo().extensionMap(m.pointer()).Range(f) + mi.extensionMap(m.pointer()).Range(f) } func (m *messageReflectWrapper) Has(fd protoreflect.FieldDescriptor) bool { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { return fi.has(m.pointer()) } else { - return m.messageInfo().extensionMap(m.pointer()).Has(xt) + return mi.extensionMap(m.pointer()).Has(xd) } } func (m *messageReflectWrapper) Clear(fd protoreflect.FieldDescriptor) { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { fi.clear(m.pointer()) } else { - m.messageInfo().extensionMap(m.pointer()).Clear(xt) + mi.extensionMap(m.pointer()).Clear(xd) } } func (m *messageReflectWrapper) Get(fd protoreflect.FieldDescriptor) protoreflect.Value { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { return fi.get(m.pointer()) } else { - return m.messageInfo().extensionMap(m.pointer()).Get(xt) + return mi.extensionMap(m.pointer()).Get(xd) } } func (m *messageReflectWrapper) Set(fd protoreflect.FieldDescriptor, v protoreflect.Value) { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { fi.set(m.pointer(), v) } else { - m.messageInfo().extensionMap(m.pointer()).Set(xt, v) + mi.extensionMap(m.pointer()).Set(xd, v) } } func (m *messageReflectWrapper) Mutable(fd protoreflect.FieldDescriptor) protoreflect.Value { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { return fi.mutable(m.pointer()) } else { - return m.messageInfo().extensionMap(m.pointer()).Mutable(xt) + return mi.extensionMap(m.pointer()).Mutable(xd) } } func (m *messageReflectWrapper) NewField(fd protoreflect.FieldDescriptor) protoreflect.Value { - m.messageInfo().init() - if fi, xt := m.messageInfo().checkField(fd); fi != nil { + mi := m.messageInfo() + mi.init() + if fi, xd := mi.checkField(fd); fi != nil { return fi.newField() } else { - return xt.New() + return xd.Type().New() } } func (m *messageReflectWrapper) WhichOneof(od protoreflect.OneofDescriptor) protoreflect.FieldDescriptor { - m.messageInfo().init() - if oi := m.messageInfo().oneofs[od.Name()]; oi != nil && oi.oneofDesc == od { + mi := m.messageInfo() + mi.init() + if oi := mi.oneofs[od.Name()]; oi != nil && oi.oneofDesc == od { return od.Fields().ByNumber(oi.which(m.pointer())) } panic("invalid oneof descriptor " + string(od.FullName()) + " for message " + string(m.Descriptor().FullName())) } func (m *messageReflectWrapper) GetUnknown() protoreflect.RawFields { - m.messageInfo().init() - return m.messageInfo().getUnknown(m.pointer()) + mi := m.messageInfo() + mi.init() + return mi.getUnknown(m.pointer()) } func (m *messageReflectWrapper) SetUnknown(b protoreflect.RawFields) { - m.messageInfo().init() - m.messageInfo().setUnknown(m.pointer(), b) + mi := m.messageInfo() + mi.init() + mi.setUnknown(m.pointer(), b) } func (m *messageReflectWrapper) IsValid() bool { return !m.pointer().IsNil() diff --git a/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go b/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go index 517e9443..da685e8a 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go +++ b/vendor/google.golang.org/protobuf/internal/impl/pointer_reflect.go @@ -16,7 +16,7 @@ import ( const UnsafeEnabled = false // Pointer is an opaque pointer type. -type Pointer interface{} +type Pointer any // offset represents the offset to a struct field, accessible from a pointer. // The offset is the field index into a struct. @@ -62,7 +62,7 @@ func pointerOfValue(v reflect.Value) pointer { } // pointerOfIface returns the pointer portion of an interface. -func pointerOfIface(v interface{}) pointer { +func pointerOfIface(v any) pointer { return pointer{v: reflect.ValueOf(v)} } @@ -93,7 +93,7 @@ func (p pointer) AsValueOf(t reflect.Type) reflect.Value { // AsIfaceOf treats p as a pointer to an object of type t and returns the value. // It is equivalent to p.AsValueOf(t).Interface() -func (p pointer) AsIfaceOf(t reflect.Type) interface{} { +func (p pointer) AsIfaceOf(t reflect.Type) any { return p.AsValueOf(t).Interface() } diff --git a/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go b/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go index 4b020e31..5f20ca5d 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go +++ b/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go @@ -50,7 +50,7 @@ func pointerOfValue(v reflect.Value) pointer { } // pointerOfIface returns the pointer portion of an interface. -func pointerOfIface(v interface{}) pointer { +func pointerOfIface(v any) pointer { type ifaceHeader struct { Type unsafe.Pointer Data unsafe.Pointer @@ -80,7 +80,7 @@ func (p pointer) AsValueOf(t reflect.Type) reflect.Value { // AsIfaceOf treats p as a pointer to an object of type t and returns the value. // It is equivalent to p.AsValueOf(t).Interface() -func (p pointer) AsIfaceOf(t reflect.Type) interface{} { +func (p pointer) AsIfaceOf(t reflect.Type) any { // TODO: Use tricky unsafe magic to directly create ifaceHeader. return p.AsValueOf(t).Interface() } diff --git a/vendor/google.golang.org/protobuf/internal/order/range.go b/vendor/google.golang.org/protobuf/internal/order/range.go index 1665a68e..a1f09162 100644 --- a/vendor/google.golang.org/protobuf/internal/order/range.go +++ b/vendor/google.golang.org/protobuf/internal/order/range.go @@ -18,7 +18,7 @@ type messageField struct { } var messageFieldPool = sync.Pool{ - New: func() interface{} { return new([]messageField) }, + New: func() any { return new([]messageField) }, } type ( @@ -69,7 +69,7 @@ type mapEntry struct { } var mapEntryPool = sync.Pool{ - New: func() interface{} { return new([]mapEntry) }, + New: func() any { return new([]mapEntry) }, } type ( diff --git a/vendor/google.golang.org/protobuf/internal/version/version.go b/vendor/google.golang.org/protobuf/internal/version/version.go index a50fcfb4..dbbf1f68 100644 --- a/vendor/google.golang.org/protobuf/internal/version/version.go +++ b/vendor/google.golang.org/protobuf/internal/version/version.go @@ -51,8 +51,8 @@ import ( // 10. Send out the CL for review and submit it. const ( Major = 1 - Minor = 33 - Patch = 0 + Minor = 34 + Patch = 2 PreRelease = "" ) diff --git a/vendor/google.golang.org/protobuf/proto/decode.go b/vendor/google.golang.org/protobuf/proto/decode.go index e5b03b56..d75a6534 100644 --- a/vendor/google.golang.org/protobuf/proto/decode.go +++ b/vendor/google.golang.org/protobuf/proto/decode.go @@ -51,6 +51,8 @@ type UnmarshalOptions struct { // Unmarshal parses the wire-format message in b and places the result in m. // The provided message must be mutable (e.g., a non-nil pointer to a message). +// +// See the [UnmarshalOptions] type if you need more control. func Unmarshal(b []byte, m Message) error { _, err := UnmarshalOptions{RecursionLimit: protowire.DefaultRecursionLimit}.unmarshal(b, m.ProtoReflect()) return err diff --git a/vendor/google.golang.org/protobuf/proto/encode.go b/vendor/google.golang.org/protobuf/proto/encode.go index 4fed202f..1f847bcc 100644 --- a/vendor/google.golang.org/protobuf/proto/encode.go +++ b/vendor/google.golang.org/protobuf/proto/encode.go @@ -5,12 +5,17 @@ package proto import ( + "errors" + "fmt" + "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/encoding/messageset" "google.golang.org/protobuf/internal/order" "google.golang.org/protobuf/internal/pragma" "google.golang.org/protobuf/reflect/protoreflect" "google.golang.org/protobuf/runtime/protoiface" + + protoerrors "google.golang.org/protobuf/internal/errors" ) // MarshalOptions configures the marshaler. @@ -70,7 +75,32 @@ type MarshalOptions struct { UseCachedSize bool } +// flags turns the specified MarshalOptions (user-facing) into +// protoiface.MarshalInputFlags (used internally by the marshaler). +// +// See impl.marshalOptions.Options for the inverse operation. +func (o MarshalOptions) flags() protoiface.MarshalInputFlags { + var flags protoiface.MarshalInputFlags + + // Note: o.AllowPartial is always forced to true by MarshalOptions.marshal, + // which is why it is not a part of MarshalInputFlags. + + if o.Deterministic { + flags |= protoiface.MarshalDeterministic + } + + if o.UseCachedSize { + flags |= protoiface.MarshalUseCachedSize + } + + return flags +} + // Marshal returns the wire-format encoding of m. +// +// This is the most common entry point for encoding a Protobuf message. +// +// See the [MarshalOptions] type if you need more control. func Marshal(m Message) ([]byte, error) { // Treat nil message interface as an empty message; nothing to output. if m == nil { @@ -116,6 +146,9 @@ func emptyBytesForMessage(m Message) []byte { // MarshalAppend appends the wire-format encoding of m to b, // returning the result. +// +// This is a less common entry point than [Marshal], which is only needed if you +// need to supply your own buffers for performance reasons. func (o MarshalOptions) MarshalAppend(b []byte, m Message) ([]byte, error) { // Treat nil message interface as an empty message; nothing to append. if m == nil { @@ -145,12 +178,7 @@ func (o MarshalOptions) marshal(b []byte, m protoreflect.Message) (out protoifac in := protoiface.MarshalInput{ Message: m, Buf: b, - } - if o.Deterministic { - in.Flags |= protoiface.MarshalDeterministic - } - if o.UseCachedSize { - in.Flags |= protoiface.MarshalUseCachedSize + Flags: o.flags(), } if methods.Size != nil { sout := methods.Size(protoiface.SizeInput{ @@ -168,6 +196,10 @@ func (o MarshalOptions) marshal(b []byte, m protoreflect.Message) (out protoifac out.Buf, err = o.marshalMessageSlow(b, m) } if err != nil { + var mismatch *protoerrors.SizeMismatchError + if errors.As(err, &mismatch) { + return out, fmt.Errorf("marshaling %s: %v", string(m.Descriptor().FullName()), err) + } return out, err } if allowPartial { diff --git a/vendor/google.golang.org/protobuf/proto/extension.go b/vendor/google.golang.org/protobuf/proto/extension.go index 17899a3a..d248f292 100644 --- a/vendor/google.golang.org/protobuf/proto/extension.go +++ b/vendor/google.golang.org/protobuf/proto/extension.go @@ -11,18 +11,21 @@ import ( // HasExtension reports whether an extension field is populated. // It returns false if m is invalid or if xt does not extend m. func HasExtension(m Message, xt protoreflect.ExtensionType) bool { - // Treat nil message interface as an empty message; no populated fields. - if m == nil { + // Treat nil message interface or descriptor as an empty message; no populated + // fields. + if m == nil || xt == nil { return false } // As a special-case, we reports invalid or mismatching descriptors // as always not being populated (since they aren't). - if xt == nil || m.ProtoReflect().Descriptor() != xt.TypeDescriptor().ContainingMessage() { + mr := m.ProtoReflect() + xd := xt.TypeDescriptor() + if mr.Descriptor() != xd.ContainingMessage() { return false } - return m.ProtoReflect().Has(xt.TypeDescriptor()) + return mr.Has(xd) } // ClearExtension clears an extension field such that subsequent @@ -36,7 +39,7 @@ func ClearExtension(m Message, xt protoreflect.ExtensionType) { // If the field is unpopulated, it returns the default value for // scalars and an immutable, empty value for lists or messages. // It panics if xt does not extend m. -func GetExtension(m Message, xt protoreflect.ExtensionType) interface{} { +func GetExtension(m Message, xt protoreflect.ExtensionType) any { // Treat nil message interface as an empty message; return the default. if m == nil { return xt.InterfaceOf(xt.Zero()) @@ -48,7 +51,7 @@ func GetExtension(m Message, xt protoreflect.ExtensionType) interface{} { // SetExtension stores the value of an extension field. // It panics if m is invalid, xt does not extend m, or if type of v // is invalid for the specified extension field. -func SetExtension(m Message, xt protoreflect.ExtensionType, v interface{}) { +func SetExtension(m Message, xt protoreflect.ExtensionType, v any) { xd := xt.TypeDescriptor() pv := xt.ValueOf(v) @@ -75,7 +78,7 @@ func SetExtension(m Message, xt protoreflect.ExtensionType, v interface{}) { // It returns immediately if f returns false. // While iterating, mutating operations may only be performed // on the current extension field. -func RangeExtensions(m Message, f func(protoreflect.ExtensionType, interface{}) bool) { +func RangeExtensions(m Message, f func(protoreflect.ExtensionType, any) bool) { // Treat nil message interface as an empty message; nothing to range over. if m == nil { return diff --git a/vendor/google.golang.org/protobuf/proto/messageset.go b/vendor/google.golang.org/protobuf/proto/messageset.go index 312d5d45..575d1483 100644 --- a/vendor/google.golang.org/protobuf/proto/messageset.go +++ b/vendor/google.golang.org/protobuf/proto/messageset.go @@ -47,11 +47,16 @@ func (o MarshalOptions) marshalMessageSet(b []byte, m protoreflect.Message) ([]b func (o MarshalOptions) marshalMessageSetField(b []byte, fd protoreflect.FieldDescriptor, value protoreflect.Value) ([]byte, error) { b = messageset.AppendFieldStart(b, fd.Number()) b = protowire.AppendTag(b, messageset.FieldMessage, protowire.BytesType) - b = protowire.AppendVarint(b, uint64(o.Size(value.Message().Interface()))) + calculatedSize := o.Size(value.Message().Interface()) + b = protowire.AppendVarint(b, uint64(calculatedSize)) + before := len(b) b, err := o.marshalMessage(b, value.Message()) if err != nil { return b, err } + if measuredSize := len(b) - before; calculatedSize != measuredSize { + return nil, errors.MismatchedSizeCalculation(calculatedSize, measuredSize) + } b = messageset.AppendFieldEnd(b) return b, nil } diff --git a/vendor/google.golang.org/protobuf/proto/size.go b/vendor/google.golang.org/protobuf/proto/size.go index f1692b49..052fb5ae 100644 --- a/vendor/google.golang.org/protobuf/proto/size.go +++ b/vendor/google.golang.org/protobuf/proto/size.go @@ -34,6 +34,7 @@ func (o MarshalOptions) size(m protoreflect.Message) (size int) { if methods != nil && methods.Size != nil { out := methods.Size(protoiface.SizeInput{ Message: m, + Flags: o.flags(), }) return out.Size } @@ -42,6 +43,7 @@ func (o MarshalOptions) size(m protoreflect.Message) (size int) { // This case is mainly used for legacy types with a Marshal method. out, _ := methods.Marshal(protoiface.MarshalInput{ Message: m, + Flags: o.flags(), }) return len(out.Buf) } diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go index baa0cc62..8fbecb4f 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go @@ -13,6 +13,7 @@ package protodesc import ( + "google.golang.org/protobuf/internal/editionssupport" "google.golang.org/protobuf/internal/errors" "google.golang.org/protobuf/internal/filedesc" "google.golang.org/protobuf/internal/pragma" @@ -91,15 +92,17 @@ func (o FileOptions) New(fd *descriptorpb.FileDescriptorProto, r Resolver) (prot switch fd.GetSyntax() { case "proto2", "": f.L1.Syntax = protoreflect.Proto2 + f.L1.Edition = filedesc.EditionProto2 case "proto3": f.L1.Syntax = protoreflect.Proto3 + f.L1.Edition = filedesc.EditionProto3 case "editions": f.L1.Syntax = protoreflect.Editions f.L1.Edition = fromEditionProto(fd.GetEdition()) default: return nil, errors.New("invalid syntax: %q", fd.GetSyntax()) } - if f.L1.Syntax == protoreflect.Editions && (fd.GetEdition() < SupportedEditionsMinimum || fd.GetEdition() > SupportedEditionsMaximum) { + if f.L1.Syntax == protoreflect.Editions && (fd.GetEdition() < editionssupport.Minimum || fd.GetEdition() > editionssupport.Maximum) { return nil, errors.New("use of edition %v not yet supported by the Go Protobuf runtime", fd.GetEdition()) } f.L1.Path = fd.GetName() @@ -114,9 +117,7 @@ func (o FileOptions) New(fd *descriptorpb.FileDescriptorProto, r Resolver) (prot opts = proto.Clone(opts).(*descriptorpb.FileOptions) f.L2.Options = func() protoreflect.ProtoMessage { return opts } } - if f.L1.Syntax == protoreflect.Editions { - initFileDescFromFeatureSet(f, fd.GetOptions().GetFeatures()) - } + initFileDescFromFeatureSet(f, fd.GetOptions().GetFeatures()) f.L2.Imports = make(filedesc.FileImports, len(fd.GetDependency())) for _, i := range fd.GetPublicDependency() { @@ -219,10 +220,10 @@ func (o FileOptions) New(fd *descriptorpb.FileDescriptorProto, r Resolver) (prot if err := validateEnumDeclarations(f.L1.Enums.List, fd.GetEnumType()); err != nil { return nil, err } - if err := validateMessageDeclarations(f.L1.Messages.List, fd.GetMessageType()); err != nil { + if err := validateMessageDeclarations(f, f.L1.Messages.List, fd.GetMessageType()); err != nil { return nil, err } - if err := validateExtensionDeclarations(f.L1.Extensions.List, fd.GetExtension()); err != nil { + if err := validateExtensionDeclarations(f, f.L1.Extensions.List, fd.GetExtension()); err != nil { return nil, err } diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go index b3278163..85617554 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go @@ -69,9 +69,7 @@ func (r descsByName) initMessagesDeclarations(mds []*descriptorpb.DescriptorProt if m.L0, err = r.makeBase(m, parent, md.GetName(), i, sb); err != nil { return nil, err } - if m.Base.L0.ParentFile.Syntax() == protoreflect.Editions { - m.L1.EditionFeatures = mergeEditionFeatures(parent, md.GetOptions().GetFeatures()) - } + m.L1.EditionFeatures = mergeEditionFeatures(parent, md.GetOptions().GetFeatures()) if opts := md.GetOptions(); opts != nil { opts = proto.Clone(opts).(*descriptorpb.MessageOptions) m.L2.Options = func() protoreflect.ProtoMessage { return opts } @@ -146,13 +144,15 @@ func (r descsByName) initFieldsFromDescriptorProto(fds []*descriptorpb.FieldDesc if f.L0, err = r.makeBase(f, parent, fd.GetName(), i, sb); err != nil { return nil, err } + f.L1.EditionFeatures = mergeEditionFeatures(parent, fd.GetOptions().GetFeatures()) f.L1.IsProto3Optional = fd.GetProto3Optional() if opts := fd.GetOptions(); opts != nil { opts = proto.Clone(opts).(*descriptorpb.FieldOptions) f.L1.Options = func() protoreflect.ProtoMessage { return opts } f.L1.IsWeak = opts.GetWeak() - f.L1.HasPacked = opts.Packed != nil - f.L1.IsPacked = opts.GetPacked() + if opts.Packed != nil { + f.L1.EditionFeatures.IsPacked = opts.GetPacked() + } } f.L1.Number = protoreflect.FieldNumber(fd.GetNumber()) f.L1.Cardinality = protoreflect.Cardinality(fd.GetLabel()) @@ -163,32 +163,12 @@ func (r descsByName) initFieldsFromDescriptorProto(fds []*descriptorpb.FieldDesc f.L1.StringName.InitJSON(fd.GetJsonName()) } - if f.Base.L0.ParentFile.Syntax() == protoreflect.Editions { - f.L1.EditionFeatures = mergeEditionFeatures(parent, fd.GetOptions().GetFeatures()) - - if f.L1.EditionFeatures.IsLegacyRequired { - f.L1.Cardinality = protoreflect.Required - } - // We reuse the existing field because the old option `[packed = - // true]` is mutually exclusive with the editions feature. - if canBePacked(fd) { - f.L1.HasPacked = true - f.L1.IsPacked = f.L1.EditionFeatures.IsPacked - } - - // We pretend this option is always explicitly set because the only - // use of HasEnforceUTF8 is to determine whether to use EnforceUTF8 - // or to return the appropriate default. - // When using editions we either parse the option or resolve the - // appropriate default here (instead of later when this option is - // requested from the descriptor). - // In proto2/proto3 syntax HasEnforceUTF8 might be false. - f.L1.HasEnforceUTF8 = true - f.L1.EnforceUTF8 = f.L1.EditionFeatures.IsUTF8Validated + if f.L1.EditionFeatures.IsLegacyRequired { + f.L1.Cardinality = protoreflect.Required + } - if f.L1.Kind == protoreflect.MessageKind && f.L1.EditionFeatures.IsDelimitedEncoded { - f.L1.Kind = protoreflect.GroupKind - } + if f.L1.Kind == protoreflect.MessageKind && f.L1.EditionFeatures.IsDelimitedEncoded { + f.L1.Kind = protoreflect.GroupKind } } return fs, nil @@ -201,12 +181,10 @@ func (r descsByName) initOneofsFromDescriptorProto(ods []*descriptorpb.OneofDesc if o.L0, err = r.makeBase(o, parent, od.GetName(), i, sb); err != nil { return nil, err } + o.L1.EditionFeatures = mergeEditionFeatures(parent, od.GetOptions().GetFeatures()) if opts := od.GetOptions(); opts != nil { opts = proto.Clone(opts).(*descriptorpb.OneofOptions) o.L1.Options = func() protoreflect.ProtoMessage { return opts } - if parent.Syntax() == protoreflect.Editions { - o.L1.EditionFeatures = mergeEditionFeatures(parent, opts.GetFeatures()) - } } } return os, nil @@ -220,10 +198,13 @@ func (r descsByName) initExtensionDeclarations(xds []*descriptorpb.FieldDescript if x.L0, err = r.makeBase(x, parent, xd.GetName(), i, sb); err != nil { return nil, err } + x.L1.EditionFeatures = mergeEditionFeatures(parent, xd.GetOptions().GetFeatures()) if opts := xd.GetOptions(); opts != nil { opts = proto.Clone(opts).(*descriptorpb.FieldOptions) x.L2.Options = func() protoreflect.ProtoMessage { return opts } - x.L2.IsPacked = opts.GetPacked() + if opts.Packed != nil { + x.L1.EditionFeatures.IsPacked = opts.GetPacked() + } } x.L1.Number = protoreflect.FieldNumber(xd.GetNumber()) x.L1.Cardinality = protoreflect.Cardinality(xd.GetLabel()) diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go index 254ca585..f3cebab2 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go @@ -46,6 +46,11 @@ func (r *resolver) resolveMessageDependencies(ms []filedesc.Message, mds []*desc if f.L1.Kind, f.L1.Enum, f.L1.Message, err = r.findTarget(f.Kind(), f.Parent().FullName(), partialName(fd.GetTypeName()), f.IsWeak()); err != nil { return errors.New("message field %q cannot resolve type: %v", f.FullName(), err) } + if f.L1.Kind == protoreflect.GroupKind && (f.IsMap() || f.IsMapEntry()) { + // A map field might inherit delimited encoding from a file-wide default feature. + // But maps never actually use delimited encoding. (At least for now...) + f.L1.Kind = protoreflect.MessageKind + } if fd.DefaultValue != nil { v, ev, err := unmarshalDefault(fd.GetDefaultValue(), f, r.allowUnresolvable) if err != nil { diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go index e4dcaf87..6de31c2e 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go @@ -45,11 +45,11 @@ func validateEnumDeclarations(es []filedesc.Enum, eds []*descriptorpb.EnumDescri if allowAlias && !foundAlias { return errors.New("enum %q allows aliases, but none were found", e.FullName()) } - if e.Syntax() == protoreflect.Proto3 { + if !e.IsClosed() { if v := e.Values().Get(0); v.Number() != 0 { - return errors.New("enum %q using proto3 semantics must have zero number for the first value", v.FullName()) + return errors.New("enum %q using open semantics must have zero number for the first value", v.FullName()) } - // Verify that value names in proto3 do not conflict if the + // Verify that value names in open enums do not conflict if the // case-insensitive prefix is removed. // See protoc v3.8.0: src/google/protobuf/descriptor.cc:4991-5055 names := map[string]protoreflect.EnumValueDescriptor{} @@ -58,7 +58,7 @@ func validateEnumDeclarations(es []filedesc.Enum, eds []*descriptorpb.EnumDescri v1 := e.Values().Get(i) s := strs.EnumValueName(strs.TrimEnumPrefix(string(v1.Name()), prefix)) if v2, ok := names[s]; ok && v1.Number() != v2.Number() { - return errors.New("enum %q using proto3 semantics has conflict: %q with %q", e.FullName(), v1.Name(), v2.Name()) + return errors.New("enum %q using open semantics has conflict: %q with %q", e.FullName(), v1.Name(), v2.Name()) } names[s] = v1 } @@ -80,7 +80,9 @@ func validateEnumDeclarations(es []filedesc.Enum, eds []*descriptorpb.EnumDescri return nil } -func validateMessageDeclarations(ms []filedesc.Message, mds []*descriptorpb.DescriptorProto) error { +func validateMessageDeclarations(file *filedesc.File, ms []filedesc.Message, mds []*descriptorpb.DescriptorProto) error { + // There are a few limited exceptions only for proto3 + isProto3 := file.L1.Edition == fromEditionProto(descriptorpb.Edition_EDITION_PROTO3) for i, md := range mds { m := &ms[i] @@ -107,25 +109,13 @@ func validateMessageDeclarations(ms []filedesc.Message, mds []*descriptorpb.Desc if isMessageSet && !flags.ProtoLegacy { return errors.New("message %q is a MessageSet, which is a legacy proto1 feature that is no longer supported", m.FullName()) } - if isMessageSet && (m.Syntax() == protoreflect.Proto3 || m.Fields().Len() > 0 || m.ExtensionRanges().Len() == 0) { + if isMessageSet && (isProto3 || m.Fields().Len() > 0 || m.ExtensionRanges().Len() == 0) { return errors.New("message %q is an invalid proto1 MessageSet", m.FullName()) } - if m.Syntax() == protoreflect.Proto3 { + if isProto3 { if m.ExtensionRanges().Len() > 0 { return errors.New("message %q using proto3 semantics cannot have extension ranges", m.FullName()) } - // Verify that field names in proto3 do not conflict if lowercased - // with all underscores removed. - // See protoc v3.8.0: src/google/protobuf/descriptor.cc:5830-5847 - names := map[string]protoreflect.FieldDescriptor{} - for i := 0; i < m.Fields().Len(); i++ { - f1 := m.Fields().Get(i) - s := strings.Replace(strings.ToLower(string(f1.Name())), "_", "", -1) - if f2, ok := names[s]; ok { - return errors.New("message %q using proto3 semantics has conflict: %q with %q", m.FullName(), f1.Name(), f2.Name()) - } - names[s] = f1 - } } for j, fd := range md.GetField() { @@ -149,7 +139,7 @@ func validateMessageDeclarations(ms []filedesc.Message, mds []*descriptorpb.Desc return errors.New("message field %q may not have extendee: %q", f.FullName(), fd.GetExtendee()) } if f.L1.IsProto3Optional { - if f.Syntax() != protoreflect.Proto3 { + if !isProto3 { return errors.New("message field %q under proto3 optional semantics must be specified in the proto3 syntax", f.FullName()) } if f.Cardinality() != protoreflect.Optional { @@ -162,26 +152,29 @@ func validateMessageDeclarations(ms []filedesc.Message, mds []*descriptorpb.Desc if f.IsWeak() && !flags.ProtoLegacy { return errors.New("message field %q is a weak field, which is a legacy proto1 feature that is no longer supported", f.FullName()) } - if f.IsWeak() && (f.Syntax() != protoreflect.Proto2 || !isOptionalMessage(f) || f.ContainingOneof() != nil) { + if f.IsWeak() && (!f.HasPresence() || !isOptionalMessage(f) || f.ContainingOneof() != nil) { return errors.New("message field %q may only be weak for an optional message", f.FullName()) } if f.IsPacked() && !isPackable(f) { return errors.New("message field %q is not packable", f.FullName()) } - if err := checkValidGroup(f); err != nil { + if err := checkValidGroup(file, f); err != nil { return errors.New("message field %q is an invalid group: %v", f.FullName(), err) } if err := checkValidMap(f); err != nil { return errors.New("message field %q is an invalid map: %v", f.FullName(), err) } - if f.Syntax() == protoreflect.Proto3 { + if isProto3 { if f.Cardinality() == protoreflect.Required { return errors.New("message field %q using proto3 semantics cannot be required", f.FullName()) } - if f.Enum() != nil && !f.Enum().IsPlaceholder() && f.Enum().Syntax() != protoreflect.Proto3 { - return errors.New("message field %q using proto3 semantics may only depend on a proto3 enum", f.FullName()) + if f.Enum() != nil && !f.Enum().IsPlaceholder() && f.Enum().IsClosed() { + return errors.New("message field %q using proto3 semantics may only depend on open enums", f.FullName()) } } + if f.Cardinality() == protoreflect.Optional && !f.HasPresence() && f.Enum() != nil && !f.Enum().IsPlaceholder() && f.Enum().IsClosed() { + return errors.New("message field %q with implicit presence may only use open enums", f.FullName()) + } } seenSynthetic := false // synthetic oneofs for proto3 optional must come after real oneofs for j := range md.GetOneofDecl() { @@ -215,17 +208,17 @@ func validateMessageDeclarations(ms []filedesc.Message, mds []*descriptorpb.Desc if err := validateEnumDeclarations(m.L1.Enums.List, md.GetEnumType()); err != nil { return err } - if err := validateMessageDeclarations(m.L1.Messages.List, md.GetNestedType()); err != nil { + if err := validateMessageDeclarations(file, m.L1.Messages.List, md.GetNestedType()); err != nil { return err } - if err := validateExtensionDeclarations(m.L1.Extensions.List, md.GetExtension()); err != nil { + if err := validateExtensionDeclarations(file, m.L1.Extensions.List, md.GetExtension()); err != nil { return err } } return nil } -func validateExtensionDeclarations(xs []filedesc.Extension, xds []*descriptorpb.FieldDescriptorProto) error { +func validateExtensionDeclarations(f *filedesc.File, xs []filedesc.Extension, xds []*descriptorpb.FieldDescriptorProto) error { for i, xd := range xds { x := &xs[i] // NOTE: Avoid using the IsValid method since extensions to MessageSet @@ -267,13 +260,13 @@ func validateExtensionDeclarations(xs []filedesc.Extension, xds []*descriptorpb. if x.IsPacked() && !isPackable(x) { return errors.New("extension field %q is not packable", x.FullName()) } - if err := checkValidGroup(x); err != nil { + if err := checkValidGroup(f, x); err != nil { return errors.New("extension field %q is an invalid group: %v", x.FullName(), err) } if md := x.Message(); md != nil && md.IsMapEntry() { return errors.New("extension field %q cannot be a map entry", x.FullName()) } - if x.Syntax() == protoreflect.Proto3 { + if f.L1.Edition == fromEditionProto(descriptorpb.Edition_EDITION_PROTO3) { switch x.ContainingMessage().FullName() { case (*descriptorpb.FileOptions)(nil).ProtoReflect().Descriptor().FullName(): case (*descriptorpb.EnumOptions)(nil).ProtoReflect().Descriptor().FullName(): @@ -309,21 +302,25 @@ func isPackable(fd protoreflect.FieldDescriptor) bool { // checkValidGroup reports whether fd is a valid group according to the same // rules that protoc imposes. -func checkValidGroup(fd protoreflect.FieldDescriptor) error { +func checkValidGroup(f *filedesc.File, fd protoreflect.FieldDescriptor) error { md := fd.Message() switch { case fd.Kind() != protoreflect.GroupKind: return nil - case fd.Syntax() == protoreflect.Proto3: + case f.L1.Edition == fromEditionProto(descriptorpb.Edition_EDITION_PROTO3): return errors.New("invalid under proto3 semantics") case md == nil || md.IsPlaceholder(): return errors.New("message must be resolvable") - case fd.FullName().Parent() != md.FullName().Parent(): - return errors.New("message and field must be declared in the same scope") - case !unicode.IsUpper(rune(md.Name()[0])): - return errors.New("message name must start with an uppercase") - case fd.Name() != protoreflect.Name(strings.ToLower(string(md.Name()))): - return errors.New("field name must be lowercased form of the message name") + } + if f.L1.Edition < fromEditionProto(descriptorpb.Edition_EDITION_2023) { + switch { + case fd.FullName().Parent() != md.FullName().Parent(): + return errors.New("message and field must be declared in the same scope") + case !unicode.IsUpper(rune(md.Name()[0])): + return errors.New("message name must start with an uppercase") + case fd.Name() != protoreflect.Name(strings.ToLower(string(md.Name()))): + return errors.New("field name must be lowercased form of the message name") + } } return nil } diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go b/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go index 2a6b29d1..804830ed 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/editions.go @@ -17,11 +17,6 @@ import ( gofeaturespb "google.golang.org/protobuf/types/gofeaturespb" ) -const ( - SupportedEditionsMinimum = descriptorpb.Edition_EDITION_PROTO2 - SupportedEditionsMaximum = descriptorpb.Edition_EDITION_2023 -) - var defaults = &descriptorpb.FeatureSetDefaults{} var defaultsCacheMu sync.Mutex var defaultsCache = make(map[filedesc.Edition]*descriptorpb.FeatureSet) @@ -67,18 +62,20 @@ func getFeatureSetFor(ed filedesc.Edition) *descriptorpb.FeatureSet { fmt.Fprintf(os.Stderr, "internal error: unsupported edition %v (did you forget to update the embedded defaults (i.e. the bootstrap descriptor proto)?)\n", edpb) os.Exit(1) } - fs := defaults.GetDefaults()[0].GetFeatures() + fsed := defaults.GetDefaults()[0] // Using a linear search for now. // Editions are guaranteed to be sorted and thus we could use a binary search. // Given that there are only a handful of editions (with one more per year) // there is not much reason to use a binary search. for _, def := range defaults.GetDefaults() { if def.GetEdition() <= edpb { - fs = def.GetFeatures() + fsed = def } else { break } } + fs := proto.Clone(fsed.GetFixedFeatures()).(*descriptorpb.FeatureSet) + proto.Merge(fs, fsed.GetOverridableFeatures()) defaultsCache[ed] = fs return fs } diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go b/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go index 9d6e0542..a5de8d40 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go @@ -73,6 +73,16 @@ func ToFileDescriptorProto(file protoreflect.FileDescriptor) *descriptorpb.FileD if syntax := file.Syntax(); syntax != protoreflect.Proto2 && syntax.IsValid() { p.Syntax = proto.String(file.Syntax().String()) } + if file.Syntax() == protoreflect.Editions { + desc := file + if fileImportDesc, ok := file.(protoreflect.FileImport); ok { + desc = fileImportDesc.FileDescriptor + } + + if editionsInterface, ok := desc.(interface{ Edition() int32 }); ok { + p.Edition = descriptorpb.Edition(editionsInterface.Edition()).Enum() + } + } return p } @@ -153,6 +163,18 @@ func ToFieldDescriptorProto(field protoreflect.FieldDescriptor) *descriptorpb.Fi if field.Syntax() == protoreflect.Proto3 && field.HasOptionalKeyword() { p.Proto3Optional = proto.Bool(true) } + if field.Syntax() == protoreflect.Editions { + // Editions have no group keyword, this type is only set so that downstream users continue + // treating this as delimited encoding. + if p.GetType() == descriptorpb.FieldDescriptorProto_TYPE_GROUP { + p.Type = descriptorpb.FieldDescriptorProto_TYPE_MESSAGE.Enum() + } + // Editions have no required keyword, this label is only set so that downstream users continue + // treating it as required. + if p.GetLabel() == descriptorpb.FieldDescriptorProto_LABEL_REQUIRED { + p.Label = descriptorpb.FieldDescriptorProto_LABEL_OPTIONAL.Enum() + } + } if field.HasDefault() { def, err := defval.Marshal(field.Default(), field.DefaultEnumValue(), field.Kind(), defval.Descriptor) if err != nil && field.DefaultEnumValue() != nil { diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go index 00b01fbd..c85bfaa5 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go @@ -161,7 +161,7 @@ const ( // IsValid reports whether the syntax is valid. func (s Syntax) IsValid() bool { switch s { - case Proto2, Proto3: + case Proto2, Proto3, Editions: return true default: return false diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go index 7dcc2ff0..ea154eec 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go @@ -373,6 +373,8 @@ func (p *SourcePath) appendFieldOptions(b []byte) []byte { b = p.appendRepeatedField(b, "edition_defaults", (*SourcePath).appendFieldOptions_EditionDefault) case 21: b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) + case 22: + b = p.appendSingularField(b, "feature_support", (*SourcePath).appendFieldOptions_FeatureSupport) case 999: b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) } @@ -483,6 +485,8 @@ func (p *SourcePath) appendEnumValueOptions(b []byte) []byte { b = p.appendSingularField(b, "features", (*SourcePath).appendFeatureSet) case 3: b = p.appendSingularField(b, "debug_redact", nil) + case 4: + b = p.appendSingularField(b, "feature_support", (*SourcePath).appendFieldOptions_FeatureSupport) case 999: b = p.appendRepeatedField(b, "uninterpreted_option", (*SourcePath).appendUninterpretedOption) } @@ -519,6 +523,23 @@ func (p *SourcePath) appendFieldOptions_EditionDefault(b []byte) []byte { return b } +func (p *SourcePath) appendFieldOptions_FeatureSupport(b []byte) []byte { + if len(*p) == 0 { + return b + } + switch (*p)[0] { + case 1: + b = p.appendSingularField(b, "edition_introduced", nil) + case 2: + b = p.appendSingularField(b, "edition_deprecated", nil) + case 3: + b = p.appendSingularField(b, "deprecation_warning", nil) + case 4: + b = p.appendSingularField(b, "edition_removed", nil) + } + return b +} + func (p *SourcePath) appendUninterpretedOption_NamePart(b []byte) []byte { if len(*p) == 0 { return b diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go index 60ff62b4..cd8fadba 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go @@ -510,7 +510,7 @@ type ExtensionType interface { // // ValueOf is more extensive than protoreflect.ValueOf for a given field's // value as it has more type information available. - ValueOf(interface{}) Value + ValueOf(any) Value // InterfaceOf completely unwraps the Value to the underlying Go type. // InterfaceOf panics if the input is nil or does not represent the @@ -519,13 +519,13 @@ type ExtensionType interface { // // InterfaceOf is able to unwrap the Value further than Value.Interface // as it has more type information available. - InterfaceOf(Value) interface{} + InterfaceOf(Value) any // IsValidValue reports whether the Value is valid to assign to the field. IsValidValue(Value) bool // IsValidInterface reports whether the input is valid to assign to the field. - IsValidInterface(interface{}) bool + IsValidInterface(any) bool } // EnumDescriptor describes an enum and @@ -544,6 +544,12 @@ type EnumDescriptor interface { // ReservedRanges is a list of reserved ranges of enum numbers. ReservedRanges() EnumRanges + // IsClosed reports whether this enum uses closed semantics. + // See https://protobuf.dev/programming-guides/enum/#definitions. + // Note: the Go protobuf implementation is not spec compliant and treats + // all enums as open enums. + IsClosed() bool + isEnumDescriptor } type isEnumDescriptor interface{ ProtoType(EnumDescriptor) } diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_pure.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_pure.go index 7ced876f..75f83a2a 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_pure.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_pure.go @@ -32,11 +32,11 @@ const ( type value struct { pragma.DoNotCompare // 0B - typ valueType // 8B - num uint64 // 8B - str string // 16B - bin []byte // 24B - iface interface{} // 16B + typ valueType // 8B + num uint64 // 8B + str string // 16B + bin []byte // 24B + iface any // 16B } func valueOfString(v string) Value { @@ -45,7 +45,7 @@ func valueOfString(v string) Value { func valueOfBytes(v []byte) Value { return Value{typ: bytesType, bin: v} } -func valueOfIface(v interface{}) Value { +func valueOfIface(v any) Value { return Value{typ: ifaceType, iface: v} } @@ -55,6 +55,6 @@ func (v Value) getString() string { func (v Value) getBytes() []byte { return v.bin } -func (v Value) getIface() interface{} { +func (v Value) getIface() any { return v.iface } diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go index 16030973..9fe83cef 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go @@ -69,8 +69,8 @@ import ( // composite Value. Modifying an empty, read-only value panics. type Value value -// The protoreflect API uses a custom Value union type instead of interface{} -// to keep the future open for performance optimizations. Using an interface{} +// The protoreflect API uses a custom Value union type instead of any +// to keep the future open for performance optimizations. Using an any // always incurs an allocation for primitives (e.g., int64) since it needs to // be boxed on the heap (as interfaces can only contain pointers natively). // Instead, we represent the Value union as a flat struct that internally keeps @@ -85,7 +85,7 @@ type Value value // ValueOf returns a Value initialized with the concrete value stored in v. // This panics if the type does not match one of the allowed types in the // Value union. -func ValueOf(v interface{}) Value { +func ValueOf(v any) Value { switch v := v.(type) { case nil: return Value{} @@ -192,10 +192,10 @@ func (v Value) IsValid() bool { return v.typ != nilType } -// Interface returns v as an interface{}. +// Interface returns v as an any. // // Invariant: v == ValueOf(v).Interface() -func (v Value) Interface() interface{} { +func (v Value) Interface() any { switch v.typ { case nilType: return nil @@ -406,8 +406,8 @@ func (k MapKey) IsValid() bool { return Value(k).IsValid() } -// Interface returns k as an interface{}. -func (k MapKey) Interface() interface{} { +// Interface returns k as an any. +func (k MapKey) Interface() any { return Value(k).Interface() } diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go index b1fdbe3e..7f3583ea 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go @@ -45,7 +45,7 @@ var ( // typeOf returns a pointer to the Go type information. // The pointer is comparable and equal if and only if the types are identical. -func typeOf(t interface{}) unsafe.Pointer { +func typeOf(t any) unsafe.Pointer { return (*ifaceHeader)(unsafe.Pointer(&t)).Type } @@ -80,7 +80,7 @@ func valueOfBytes(v []byte) Value { p := (*sliceHeader)(unsafe.Pointer(&v)) return Value{typ: bytesType, ptr: p.Data, num: uint64(len(v))} } -func valueOfIface(v interface{}) Value { +func valueOfIface(v any) Value { p := (*ifaceHeader)(unsafe.Pointer(&v)) return Value{typ: p.Type, ptr: p.Data} } @@ -93,7 +93,7 @@ func (v Value) getBytes() (x []byte) { *(*sliceHeader)(unsafe.Pointer(&x)) = sliceHeader{Data: v.ptr, Len: int(v.num), Cap: int(v.num)} return x } -func (v Value) getIface() (x interface{}) { +func (v Value) getIface() (x any) { *(*ifaceHeader)(unsafe.Pointer(&x)) = ifaceHeader{Type: v.typ, Data: v.ptr} return x } diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go index 43547011..f7d38699 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go @@ -15,7 +15,7 @@ import ( type ( ifaceHeader struct { - _ [0]interface{} // if interfaces have greater alignment than unsafe.Pointer, this will enforce it. + _ [0]any // if interfaces have greater alignment than unsafe.Pointer, this will enforce it. Type unsafe.Pointer Data unsafe.Pointer } @@ -37,7 +37,7 @@ var ( // typeOf returns a pointer to the Go type information. // The pointer is comparable and equal if and only if the types are identical. -func typeOf(t interface{}) unsafe.Pointer { +func typeOf(t any) unsafe.Pointer { return (*ifaceHeader)(unsafe.Pointer(&t)).Type } @@ -70,7 +70,7 @@ func valueOfString(v string) Value { func valueOfBytes(v []byte) Value { return Value{typ: bytesType, ptr: unsafe.Pointer(unsafe.SliceData(v)), num: uint64(len(v))} } -func valueOfIface(v interface{}) Value { +func valueOfIface(v any) Value { p := (*ifaceHeader)(unsafe.Pointer(&v)) return Value{typ: p.Type, ptr: p.Data} } @@ -81,7 +81,7 @@ func (v Value) getString() string { func (v Value) getBytes() []byte { return unsafe.Slice((*byte)(v.ptr), v.num) } -func (v Value) getIface() (x interface{}) { +func (v Value) getIface() (x any) { *(*ifaceHeader)(unsafe.Pointer(&x)) = ifaceHeader{Type: v.typ, Data: v.ptr} return x } diff --git a/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go b/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go index 6267dc52..de177733 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go +++ b/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go @@ -95,7 +95,7 @@ type Files struct { // multiple files. Only top-level declarations are registered. // Note that enum values are in the top-level since that are in the same // scope as the parent enum. - descsByName map[protoreflect.FullName]interface{} + descsByName map[protoreflect.FullName]any filesByPath map[string][]protoreflect.FileDescriptor numFiles int } @@ -117,7 +117,7 @@ func (r *Files) RegisterFile(file protoreflect.FileDescriptor) error { defer globalMutex.Unlock() } if r.descsByName == nil { - r.descsByName = map[protoreflect.FullName]interface{}{ + r.descsByName = map[protoreflect.FullName]any{ "": &packageDescriptor{}, } r.filesByPath = make(map[string][]protoreflect.FileDescriptor) @@ -485,7 +485,7 @@ type Types struct { } type ( - typesByName map[protoreflect.FullName]interface{} + typesByName map[protoreflect.FullName]any extensionsByMessage map[protoreflect.FullName]extensionsByNumber extensionsByNumber map[protoreflect.FieldNumber]protoreflect.ExtensionType ) @@ -570,7 +570,7 @@ func (r *Types) RegisterExtension(xt protoreflect.ExtensionType) error { return nil } -func (r *Types) register(kind string, desc protoreflect.Descriptor, typ interface{}) error { +func (r *Types) register(kind string, desc protoreflect.Descriptor, typ any) error { name := desc.FullName() prev := r.typesByName[name] if prev != nil { @@ -841,7 +841,7 @@ func (r *Types) RangeExtensionsByMessage(message protoreflect.FullName, f func(p } } -func typeName(t interface{}) string { +func typeName(t any) string { switch t.(type) { case protoreflect.EnumType: return "enum" @@ -854,7 +854,7 @@ func typeName(t interface{}) string { } } -func amendErrorWithCaller(err error, prev, curr interface{}) error { +func amendErrorWithCaller(err error, prev, curr any) error { prevPkg := goPackage(prev) currPkg := goPackage(curr) if prevPkg == "" || currPkg == "" || prevPkg == currPkg { @@ -863,7 +863,7 @@ func amendErrorWithCaller(err error, prev, curr interface{}) error { return errors.New("%s\n\tpreviously from: %q\n\tcurrently from: %q", err, prevPkg, currPkg) } -func goPackage(v interface{}) string { +func goPackage(v any) string { switch d := v.(type) { case protoreflect.EnumType: v = d.Descriptor() diff --git a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go index 78624cf6..9403eb07 100644 --- a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go +++ b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go @@ -54,6 +54,9 @@ type Edition int32 const ( // A placeholder for an unknown edition value. Edition_EDITION_UNKNOWN Edition = 0 + // A placeholder edition for specifying default behaviors *before* a feature + // was first introduced. This is effectively an "infinite past". + Edition_EDITION_LEGACY Edition = 900 // Legacy syntax "editions". These pre-date editions, but behave much like // distinct editions. These can't be used to specify the edition of proto // files, but feature definitions must supply proto2/proto3 defaults for @@ -82,6 +85,7 @@ const ( var ( Edition_name = map[int32]string{ 0: "EDITION_UNKNOWN", + 900: "EDITION_LEGACY", 998: "EDITION_PROTO2", 999: "EDITION_PROTO3", 1000: "EDITION_2023", @@ -95,6 +99,7 @@ var ( } Edition_value = map[string]int32{ "EDITION_UNKNOWN": 0, + "EDITION_LEGACY": 900, "EDITION_PROTO2": 998, "EDITION_PROTO3": 999, "EDITION_2023": 1000, @@ -2177,12 +2182,16 @@ type FileOptions struct { // // Deprecated: Marked as deprecated in google/protobuf/descriptor.proto. JavaGenerateEqualsAndHash *bool `protobuf:"varint,20,opt,name=java_generate_equals_and_hash,json=javaGenerateEqualsAndHash" json:"java_generate_equals_and_hash,omitempty"` - // If set true, then the Java2 code generator will generate code that - // throws an exception whenever an attempt is made to assign a non-UTF-8 - // byte sequence to a string field. - // Message reflection will do the same. - // However, an extension field still accepts non-UTF-8 byte sequences. - // This option has no effect on when used with the lite runtime. + // A proto2 file can set this to true to opt in to UTF-8 checking for Java, + // which will throw an exception if invalid UTF-8 is parsed from the wire or + // assigned to a string field. + // + // TODO: clarify exactly what kinds of field types this option + // applies to, and update these docs accordingly. + // + // Proto3 files already perform these checks. Setting the option explicitly to + // false has no effect: it cannot be used to opt proto3 files out of UTF-8 + // checks. JavaStringCheckUtf8 *bool `protobuf:"varint,27,opt,name=java_string_check_utf8,json=javaStringCheckUtf8,def=0" json:"java_string_check_utf8,omitempty"` OptimizeFor *FileOptions_OptimizeMode `protobuf:"varint,9,opt,name=optimize_for,json=optimizeFor,enum=google.protobuf.FileOptions_OptimizeMode,def=1" json:"optimize_for,omitempty"` // Sets the Go package where structs generated from this .proto will be @@ -2679,7 +2688,8 @@ type FieldOptions struct { Targets []FieldOptions_OptionTargetType `protobuf:"varint,19,rep,name=targets,enum=google.protobuf.FieldOptions_OptionTargetType" json:"targets,omitempty"` EditionDefaults []*FieldOptions_EditionDefault `protobuf:"bytes,20,rep,name=edition_defaults,json=editionDefaults" json:"edition_defaults,omitempty"` // Any features defined in the specific edition. - Features *FeatureSet `protobuf:"bytes,21,opt,name=features" json:"features,omitempty"` + Features *FeatureSet `protobuf:"bytes,21,opt,name=features" json:"features,omitempty"` + FeatureSupport *FieldOptions_FeatureSupport `protobuf:"bytes,22,opt,name=feature_support,json=featureSupport" json:"feature_support,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` } @@ -2811,6 +2821,13 @@ func (x *FieldOptions) GetFeatures() *FeatureSet { return nil } +func (x *FieldOptions) GetFeatureSupport() *FieldOptions_FeatureSupport { + if x != nil { + return x.FeatureSupport + } + return nil +} + func (x *FieldOptions) GetUninterpretedOption() []*UninterpretedOption { if x != nil { return x.UninterpretedOption @@ -2995,6 +3012,8 @@ type EnumValueOptions struct { // out when using debug formats, e.g. when the field contains sensitive // credentials. DebugRedact *bool `protobuf:"varint,3,opt,name=debug_redact,json=debugRedact,def=0" json:"debug_redact,omitempty"` + // Information about the support window of a feature value. + FeatureSupport *FieldOptions_FeatureSupport `protobuf:"bytes,4,opt,name=feature_support,json=featureSupport" json:"feature_support,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` } @@ -3058,6 +3077,13 @@ func (x *EnumValueOptions) GetDebugRedact() bool { return Default_EnumValueOptions_DebugRedact } +func (x *EnumValueOptions) GetFeatureSupport() *FieldOptions_FeatureSupport { + if x != nil { + return x.FeatureSupport + } + return nil +} + func (x *EnumValueOptions) GetUninterpretedOption() []*UninterpretedOption { if x != nil { return x.UninterpretedOption @@ -3968,6 +3994,88 @@ func (x *FieldOptions_EditionDefault) GetValue() string { return "" } +// Information about the support window of a feature. +type FieldOptions_FeatureSupport struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + // The edition that this feature was first available in. In editions + // earlier than this one, the default assigned to EDITION_LEGACY will be + // used, and proto files will not be able to override it. + EditionIntroduced *Edition `protobuf:"varint,1,opt,name=edition_introduced,json=editionIntroduced,enum=google.protobuf.Edition" json:"edition_introduced,omitempty"` + // The edition this feature becomes deprecated in. Using this after this + // edition may trigger warnings. + EditionDeprecated *Edition `protobuf:"varint,2,opt,name=edition_deprecated,json=editionDeprecated,enum=google.protobuf.Edition" json:"edition_deprecated,omitempty"` + // The deprecation warning text if this feature is used after the edition it + // was marked deprecated in. + DeprecationWarning *string `protobuf:"bytes,3,opt,name=deprecation_warning,json=deprecationWarning" json:"deprecation_warning,omitempty"` + // The edition this feature is no longer available in. In editions after + // this one, the last default assigned will be used, and proto files will + // not be able to override it. + EditionRemoved *Edition `protobuf:"varint,4,opt,name=edition_removed,json=editionRemoved,enum=google.protobuf.Edition" json:"edition_removed,omitempty"` +} + +func (x *FieldOptions_FeatureSupport) Reset() { + *x = FieldOptions_FeatureSupport{} + if protoimpl.UnsafeEnabled { + mi := &file_google_protobuf_descriptor_proto_msgTypes[28] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *FieldOptions_FeatureSupport) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*FieldOptions_FeatureSupport) ProtoMessage() {} + +func (x *FieldOptions_FeatureSupport) ProtoReflect() protoreflect.Message { + mi := &file_google_protobuf_descriptor_proto_msgTypes[28] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use FieldOptions_FeatureSupport.ProtoReflect.Descriptor instead. +func (*FieldOptions_FeatureSupport) Descriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{12, 1} +} + +func (x *FieldOptions_FeatureSupport) GetEditionIntroduced() Edition { + if x != nil && x.EditionIntroduced != nil { + return *x.EditionIntroduced + } + return Edition_EDITION_UNKNOWN +} + +func (x *FieldOptions_FeatureSupport) GetEditionDeprecated() Edition { + if x != nil && x.EditionDeprecated != nil { + return *x.EditionDeprecated + } + return Edition_EDITION_UNKNOWN +} + +func (x *FieldOptions_FeatureSupport) GetDeprecationWarning() string { + if x != nil && x.DeprecationWarning != nil { + return *x.DeprecationWarning + } + return "" +} + +func (x *FieldOptions_FeatureSupport) GetEditionRemoved() Edition { + if x != nil && x.EditionRemoved != nil { + return *x.EditionRemoved + } + return Edition_EDITION_UNKNOWN +} + // The name of the uninterpreted option. Each string represents a segment in // a dot-separated name. is_extension is true iff a segment represents an // extension (denoted with parentheses in options specs in .proto files). @@ -3985,7 +4093,7 @@ type UninterpretedOption_NamePart struct { func (x *UninterpretedOption_NamePart) Reset() { *x = UninterpretedOption_NamePart{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[28] + mi := &file_google_protobuf_descriptor_proto_msgTypes[29] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -3998,7 +4106,7 @@ func (x *UninterpretedOption_NamePart) String() string { func (*UninterpretedOption_NamePart) ProtoMessage() {} func (x *UninterpretedOption_NamePart) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[28] + mi := &file_google_protobuf_descriptor_proto_msgTypes[29] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4037,14 +4145,17 @@ type FeatureSetDefaults_FeatureSetEditionDefault struct { sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - Edition *Edition `protobuf:"varint,3,opt,name=edition,enum=google.protobuf.Edition" json:"edition,omitempty"` - Features *FeatureSet `protobuf:"bytes,2,opt,name=features" json:"features,omitempty"` + Edition *Edition `protobuf:"varint,3,opt,name=edition,enum=google.protobuf.Edition" json:"edition,omitempty"` + // Defaults of features that can be overridden in this edition. + OverridableFeatures *FeatureSet `protobuf:"bytes,4,opt,name=overridable_features,json=overridableFeatures" json:"overridable_features,omitempty"` + // Defaults of features that can't be overridden in this edition. + FixedFeatures *FeatureSet `protobuf:"bytes,5,opt,name=fixed_features,json=fixedFeatures" json:"fixed_features,omitempty"` } func (x *FeatureSetDefaults_FeatureSetEditionDefault) Reset() { *x = FeatureSetDefaults_FeatureSetEditionDefault{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[29] + mi := &file_google_protobuf_descriptor_proto_msgTypes[30] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4057,7 +4168,7 @@ func (x *FeatureSetDefaults_FeatureSetEditionDefault) String() string { func (*FeatureSetDefaults_FeatureSetEditionDefault) ProtoMessage() {} func (x *FeatureSetDefaults_FeatureSetEditionDefault) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[29] + mi := &file_google_protobuf_descriptor_proto_msgTypes[30] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4080,9 +4191,16 @@ func (x *FeatureSetDefaults_FeatureSetEditionDefault) GetEdition() Edition { return Edition_EDITION_UNKNOWN } -func (x *FeatureSetDefaults_FeatureSetEditionDefault) GetFeatures() *FeatureSet { +func (x *FeatureSetDefaults_FeatureSetEditionDefault) GetOverridableFeatures() *FeatureSet { if x != nil { - return x.Features + return x.OverridableFeatures + } + return nil +} + +func (x *FeatureSetDefaults_FeatureSetEditionDefault) GetFixedFeatures() *FeatureSet { + if x != nil { + return x.FixedFeatures } return nil } @@ -4188,7 +4306,7 @@ type SourceCodeInfo_Location struct { func (x *SourceCodeInfo_Location) Reset() { *x = SourceCodeInfo_Location{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[30] + mi := &file_google_protobuf_descriptor_proto_msgTypes[31] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4201,7 +4319,7 @@ func (x *SourceCodeInfo_Location) String() string { func (*SourceCodeInfo_Location) ProtoMessage() {} func (x *SourceCodeInfo_Location) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[30] + mi := &file_google_protobuf_descriptor_proto_msgTypes[31] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4275,7 +4393,7 @@ type GeneratedCodeInfo_Annotation struct { func (x *GeneratedCodeInfo_Annotation) Reset() { *x = GeneratedCodeInfo_Annotation{} if protoimpl.UnsafeEnabled { - mi := &file_google_protobuf_descriptor_proto_msgTypes[31] + mi := &file_google_protobuf_descriptor_proto_msgTypes[32] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4288,7 +4406,7 @@ func (x *GeneratedCodeInfo_Annotation) String() string { func (*GeneratedCodeInfo_Annotation) ProtoMessage() {} func (x *GeneratedCodeInfo_Annotation) ProtoReflect() protoreflect.Message { - mi := &file_google_protobuf_descriptor_proto_msgTypes[31] + mi := &file_google_protobuf_descriptor_proto_msgTypes[32] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4597,7 +4715,7 @@ var file_google_protobuf_descriptor_proto_rawDesc = []byte{ 0x67, 0x12, 0x30, 0x0a, 0x10, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0f, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, - 0x69, 0x6e, 0x67, 0x22, 0x97, 0x09, 0x0a, 0x0b, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, + 0x69, 0x6e, 0x67, 0x22, 0xad, 0x09, 0x0a, 0x0b, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x21, 0x0a, 0x0c, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x6a, 0x61, 0x76, 0x61, 0x50, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x30, 0x0a, 0x14, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x6f, @@ -4670,405 +4788,445 @@ var file_google_protobuf_descriptor_proto_rawDesc = []byte{ 0x45, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x43, 0x4f, 0x44, 0x45, 0x5f, 0x53, 0x49, 0x5a, 0x45, 0x10, 0x02, 0x12, 0x10, 0x0a, 0x0c, 0x4c, 0x49, 0x54, 0x45, 0x5f, 0x52, 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x03, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, - 0x02, 0x4a, 0x04, 0x08, 0x2a, 0x10, 0x2b, 0x4a, 0x04, 0x08, 0x26, 0x10, 0x27, 0x22, 0xf4, 0x03, - 0x0a, 0x0e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x12, 0x3c, 0x0a, 0x17, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x73, 0x65, 0x74, 0x5f, - 0x77, 0x69, 0x72, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x14, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, - 0x65, 0x53, 0x65, 0x74, 0x57, 0x69, 0x72, 0x65, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, 0x4c, - 0x0a, 0x1f, 0x6e, 0x6f, 0x5f, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x5f, 0x64, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, - 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x1c, - 0x6e, 0x6f, 0x53, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x12, 0x25, 0x0a, 0x0a, - 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, - 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, - 0x74, 0x65, 0x64, 0x12, 0x1b, 0x0a, 0x09, 0x6d, 0x61, 0x70, 0x5f, 0x65, 0x6e, 0x74, 0x72, 0x79, - 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x6d, 0x61, 0x70, 0x45, 0x6e, 0x74, 0x72, 0x79, - 0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x6c, - 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, - 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x08, - 0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, - 0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x43, - 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, - 0x75, 0x72, 0x65, 0x73, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, - 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, - 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, - 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, 0x4a, 0x04, 0x08, 0x05, - 0x10, 0x06, 0x4a, 0x04, 0x08, 0x06, 0x10, 0x07, 0x4a, 0x04, 0x08, 0x08, 0x10, 0x09, 0x4a, 0x04, - 0x08, 0x09, 0x10, 0x0a, 0x22, 0xad, 0x0a, 0x0a, 0x0c, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x41, 0x0a, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0e, 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x2e, 0x43, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, - 0x47, 0x52, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x70, 0x61, 0x63, 0x6b, - 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x06, 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64, - 0x12, 0x47, 0x0a, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, - 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, - 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, - 0x4c, 0x52, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, 0x12, 0x19, 0x0a, 0x04, 0x6c, 0x61, 0x7a, - 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04, - 0x6c, 0x61, 0x7a, 0x79, 0x12, 0x2e, 0x0a, 0x0f, 0x75, 0x6e, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, - 0x65, 0x64, 0x5f, 0x6c, 0x61, 0x7a, 0x79, 0x18, 0x0f, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, - 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0e, 0x75, 0x6e, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x65, 0x64, - 0x4c, 0x61, 0x7a, 0x79, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, - 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, - 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x19, 0x0a, 0x04, 0x77, - 0x65, 0x61, 0x6b, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, - 0x52, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x12, 0x28, 0x0a, 0x0c, 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, - 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x10, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, - 0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, 0x65, 0x62, 0x75, 0x67, 0x52, 0x65, 0x64, 0x61, 0x63, 0x74, - 0x12, 0x4b, 0x0a, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x11, 0x20, - 0x01, 0x28, 0x0e, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, - 0x6f, 0x6e, 0x52, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x48, 0x0a, - 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x18, 0x13, 0x20, 0x03, 0x28, 0x0e, 0x32, 0x2e, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, 0x79, 0x70, 0x65, 0x52, 0x07, - 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x12, 0x57, 0x0a, 0x10, 0x65, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x5f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x18, 0x14, 0x20, 0x03, 0x28, - 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x52, - 0x0f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, - 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x15, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, - 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, - 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, - 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x1a, 0x5a, 0x0a, 0x0e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, - 0x66, 0x61, 0x75, 0x6c, 0x74, 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, - 0x2f, 0x0a, 0x05, 0x43, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0a, 0x0a, 0x06, 0x53, 0x54, 0x52, 0x49, - 0x4e, 0x47, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x43, 0x4f, 0x52, 0x44, 0x10, 0x01, 0x12, 0x10, - 0x0a, 0x0c, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x5f, 0x50, 0x49, 0x45, 0x43, 0x45, 0x10, 0x02, - 0x22, 0x35, 0x0a, 0x06, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, - 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x10, 0x00, 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, - 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, - 0x55, 0x4d, 0x42, 0x45, 0x52, 0x10, 0x02, 0x22, 0x55, 0x0a, 0x0f, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, - 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, - 0x00, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x52, - 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x01, 0x12, 0x14, 0x0a, 0x10, 0x52, 0x45, 0x54, 0x45, - 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, 0x10, 0x02, 0x22, 0x8c, - 0x02, 0x0a, 0x10, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, - 0x79, 0x70, 0x65, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, - 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, - 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x4c, 0x45, - 0x10, 0x01, 0x12, 0x1f, 0x0a, 0x1b, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, - 0x45, 0x5f, 0x45, 0x58, 0x54, 0x45, 0x4e, 0x53, 0x49, 0x4f, 0x4e, 0x5f, 0x52, 0x41, 0x4e, 0x47, - 0x45, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, - 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x03, 0x12, 0x15, 0x0a, 0x11, - 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, 0x49, 0x45, 0x4c, - 0x44, 0x10, 0x04, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, - 0x50, 0x45, 0x5f, 0x4f, 0x4e, 0x45, 0x4f, 0x46, 0x10, 0x05, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x41, - 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x10, 0x06, - 0x12, 0x1a, 0x0a, 0x16, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x59, 0x10, 0x07, 0x12, 0x17, 0x0a, 0x13, - 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, - 0x49, 0x43, 0x45, 0x10, 0x08, 0x12, 0x16, 0x0a, 0x12, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, - 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x54, 0x48, 0x4f, 0x44, 0x10, 0x09, 0x2a, 0x09, 0x08, - 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, 0x4a, 0x04, - 0x08, 0x12, 0x10, 0x13, 0x22, 0xac, 0x01, 0x0a, 0x0c, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, - 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, - 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, - 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, - 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, - 0x80, 0x80, 0x02, 0x22, 0xd1, 0x02, 0x0a, 0x0b, 0x45, 0x6e, 0x75, 0x6d, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x12, 0x1f, 0x0a, 0x0b, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x5f, 0x61, 0x6c, 0x69, - 0x61, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0a, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x41, - 0x6c, 0x69, 0x61, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, - 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, - 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x56, 0x0a, 0x26, 0x64, - 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, - 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, - 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, - 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x4c, 0x65, 0x67, 0x61, 0x63, - 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69, - 0x63, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, - 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, - 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, - 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, + 0x02, 0x4a, 0x04, 0x08, 0x2a, 0x10, 0x2b, 0x4a, 0x04, 0x08, 0x26, 0x10, 0x27, 0x52, 0x14, 0x70, + 0x68, 0x70, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, + 0x63, 0x65, 0x73, 0x22, 0xf4, 0x03, 0x0a, 0x0e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x3c, 0x0a, 0x17, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, + 0x65, 0x5f, 0x73, 0x65, 0x74, 0x5f, 0x77, 0x69, 0x72, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, + 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x14, + 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x57, 0x69, 0x72, 0x65, 0x46, 0x6f, + 0x72, 0x6d, 0x61, 0x74, 0x12, 0x4c, 0x0a, 0x1f, 0x6e, 0x6f, 0x5f, 0x73, 0x74, 0x61, 0x6e, 0x64, + 0x61, 0x72, 0x64, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x61, + 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, + 0x61, 0x6c, 0x73, 0x65, 0x52, 0x1c, 0x6e, 0x6f, 0x53, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, + 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, + 0x6f, 0x72, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, + 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x1b, 0x0a, 0x09, 0x6d, 0x61, 0x70, + 0x5f, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x6d, 0x61, + 0x70, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, + 0x61, 0x74, 0x65, 0x64, 0x5f, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, + 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, + 0x18, 0x0b, 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, + 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, + 0x46, 0x69, 0x65, 0x6c, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x37, + 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, + 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, + 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, + 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, + 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, - 0x02, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x22, 0x81, 0x02, 0x0a, 0x10, 0x45, 0x6e, 0x75, 0x6d, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, - 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, - 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, - 0x74, 0x65, 0x64, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, - 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x28, 0x0a, 0x0c, - 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, + 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x04, + 0x10, 0x05, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x4a, 0x04, 0x08, 0x06, 0x10, 0x07, 0x4a, 0x04, + 0x08, 0x08, 0x10, 0x09, 0x4a, 0x04, 0x08, 0x09, 0x10, 0x0a, 0x22, 0x9d, 0x0d, 0x0a, 0x0c, 0x46, + 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x41, 0x0a, 0x05, 0x63, + 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, + 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x43, 0x54, 0x79, 0x70, 0x65, 0x3a, + 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x52, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x12, 0x16, + 0x0a, 0x06, 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x06, + 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64, 0x12, 0x47, 0x0a, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, + 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x09, 0x4a, 0x53, + 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x52, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, 0x12, + 0x19, 0x0a, 0x04, 0x6c, 0x61, 0x7a, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, + 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04, 0x6c, 0x61, 0x7a, 0x79, 0x12, 0x2e, 0x0a, 0x0f, 0x75, 0x6e, + 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x65, 0x64, 0x5f, 0x6c, 0x61, 0x7a, 0x79, 0x18, 0x0f, 0x20, + 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0e, 0x75, 0x6e, 0x76, 0x65, + 0x72, 0x69, 0x66, 0x69, 0x65, 0x64, 0x4c, 0x61, 0x7a, 0x79, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, + 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, + 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, + 0x64, 0x12, 0x19, 0x0a, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x3a, + 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x12, 0x28, 0x0a, 0x0c, + 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x10, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, 0x65, 0x62, 0x75, 0x67, - 0x52, 0x65, 0x64, 0x61, 0x63, 0x74, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, + 0x52, 0x65, 0x64, 0x61, 0x63, 0x74, 0x12, 0x4b, 0x0a, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, + 0x69, 0x6f, 0x6e, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, + 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, + 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x48, 0x0a, 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x18, 0x13, + 0x20, 0x03, 0x28, 0x0e, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, + 0x54, 0x79, 0x70, 0x65, 0x52, 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x12, 0x57, 0x0a, + 0x10, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, + 0x73, 0x18, 0x14, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, + 0x66, 0x61, 0x75, 0x6c, 0x74, 0x52, 0x0f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, + 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, + 0x65, 0x73, 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, + 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, + 0x55, 0x0a, 0x0f, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x5f, 0x73, 0x75, 0x70, 0x70, 0x6f, + 0x72, 0x74, 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, + 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, + 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x52, 0x0e, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, + 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xd5, 0x01, 0x0a, 0x0e, - 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37, - 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, - 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, - 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, - 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x58, - 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, - 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, + 0x1a, 0x5a, 0x0a, 0x0e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, + 0x6c, 0x74, 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, + 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x65, + 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, + 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0x96, 0x02, 0x0a, + 0x0e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x12, + 0x47, 0x0a, 0x12, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x74, 0x72, 0x6f, + 0x64, 0x75, 0x63, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x11, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x49, 0x6e, + 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x12, 0x47, 0x0a, 0x12, 0x65, 0x64, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x5f, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x02, + 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x11, + 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, + 0x64, 0x12, 0x2f, 0x0a, 0x13, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x5f, 0x77, 0x61, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x12, + 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x57, 0x61, 0x72, 0x6e, 0x69, + 0x6e, 0x67, 0x12, 0x41, 0x0a, 0x0f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, + 0x6d, 0x6f, 0x76, 0x65, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, + 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0e, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, + 0x6d, 0x6f, 0x76, 0x65, 0x64, 0x22, 0x2f, 0x0a, 0x05, 0x43, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0a, + 0x0a, 0x06, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x43, 0x4f, + 0x52, 0x44, 0x10, 0x01, 0x12, 0x10, 0x0a, 0x0c, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x5f, 0x50, + 0x49, 0x45, 0x43, 0x45, 0x10, 0x02, 0x22, 0x35, 0x0a, 0x06, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, + 0x12, 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x10, 0x00, 0x12, + 0x0d, 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0d, + 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x55, 0x4d, 0x42, 0x45, 0x52, 0x10, 0x02, 0x22, 0x55, 0x0a, + 0x0f, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, + 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, + 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, + 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x52, 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x01, 0x12, 0x14, + 0x0a, 0x10, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, 0x4f, 0x55, 0x52, + 0x43, 0x45, 0x10, 0x02, 0x22, 0x8c, 0x02, 0x0a, 0x10, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, + 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, + 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, + 0x10, 0x00, 0x12, 0x14, 0x0a, 0x10, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, + 0x45, 0x5f, 0x46, 0x49, 0x4c, 0x45, 0x10, 0x01, 0x12, 0x1f, 0x0a, 0x1b, 0x54, 0x41, 0x52, 0x47, + 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x58, 0x54, 0x45, 0x4e, 0x53, 0x49, 0x4f, + 0x4e, 0x5f, 0x52, 0x41, 0x4e, 0x47, 0x45, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, + 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, + 0x10, 0x03, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, + 0x45, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x10, 0x04, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, + 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4f, 0x4e, 0x45, 0x4f, 0x46, 0x10, 0x05, + 0x12, 0x14, 0x0a, 0x10, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, + 0x45, 0x4e, 0x55, 0x4d, 0x10, 0x06, 0x12, 0x1a, 0x0a, 0x16, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, + 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x59, + 0x10, 0x07, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, + 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x10, 0x08, 0x12, 0x16, 0x0a, 0x12, 0x54, + 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x54, 0x48, 0x4f, + 0x44, 0x10, 0x09, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, + 0x08, 0x04, 0x10, 0x05, 0x4a, 0x04, 0x08, 0x12, 0x10, 0x13, 0x22, 0xac, 0x01, 0x0a, 0x0c, 0x4f, + 0x6e, 0x65, 0x6f, 0x66, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, + 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, - 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, - 0x80, 0x80, 0x02, 0x22, 0x99, 0x03, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, - 0x74, 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, - 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x71, 0x0a, 0x11, - 0x69, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x5f, 0x6c, 0x65, 0x76, 0x65, - 0x6c, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, - 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x3a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, - 0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x52, 0x10, 0x69, - 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, - 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x23, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, - 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, - 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, - 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, - 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x22, 0x50, 0x0a, 0x10, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, - 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x17, 0x0a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, - 0x54, 0x45, 0x4e, 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, - 0x13, 0x0a, 0x0f, 0x4e, 0x4f, 0x5f, 0x53, 0x49, 0x44, 0x45, 0x5f, 0x45, 0x46, 0x46, 0x45, 0x43, - 0x54, 0x53, 0x10, 0x01, 0x12, 0x0e, 0x0a, 0x0a, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, - 0x4e, 0x54, 0x10, 0x02, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, - 0x9a, 0x03, 0x0a, 0x13, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, - 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, - 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, - 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4e, 0x61, 0x6d, 0x65, - 0x50, 0x61, 0x72, 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x29, 0x0a, 0x10, 0x69, 0x64, - 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, - 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, - 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x04, 0x52, 0x10, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, - 0x69, 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52, - 0x10, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x01, 0x52, 0x0b, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, - 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x27, 0x0a, 0x0f, 0x61, 0x67, 0x67, 0x72, 0x65, - 0x67, 0x61, 0x74, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x0e, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x1a, 0x4a, 0x0a, 0x08, 0x4e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x12, 0x1b, 0x0a, 0x09, - 0x6e, 0x61, 0x6d, 0x65, 0x5f, 0x70, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x02, 0x28, 0x09, 0x52, - 0x08, 0x6e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x12, 0x21, 0x0a, 0x0c, 0x69, 0x73, 0x5f, - 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x02, 0x28, 0x08, 0x52, - 0x0b, 0x69, 0x73, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x22, 0x8c, 0x0a, 0x0a, - 0x0a, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x12, 0x8b, 0x01, 0x0a, 0x0e, - 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, - 0x74, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x42, - 0x39, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, - 0x58, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x49, - 0x4d, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x18, 0xe7, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, - 0x58, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x18, 0xe8, 0x07, 0x52, 0x0d, 0x66, 0x69, 0x65, 0x6c, - 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x66, 0x0a, 0x09, 0x65, 0x6e, 0x75, - 0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, + 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, + 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, + 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, + 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, + 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, + 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, + 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xd1, 0x02, 0x0a, 0x0b, 0x45, 0x6e, + 0x75, 0x6d, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x1f, 0x0a, 0x0b, 0x61, 0x6c, 0x6c, + 0x6f, 0x77, 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0a, + 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x41, 0x6c, 0x69, 0x61, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, + 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, + 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, + 0x64, 0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, + 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, + 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, + 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, + 0x64, 0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, + 0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, + 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, + 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, + 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, + 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, + 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, + 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, + 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, + 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x22, 0xd8, 0x02, + 0x0a, 0x10, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, + 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, + 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, + 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, + 0x65, 0x73, 0x12, 0x28, 0x0a, 0x0c, 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, 0x72, 0x65, 0x64, 0x61, + 0x63, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, + 0x0b, 0x64, 0x65, 0x62, 0x75, 0x67, 0x52, 0x65, 0x64, 0x61, 0x63, 0x74, 0x12, 0x55, 0x0a, 0x0f, + 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x5f, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x18, + 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x75, 0x70, 0x70, + 0x6f, 0x72, 0x74, 0x52, 0x0e, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x75, 0x70, 0x70, + 0x6f, 0x72, 0x74, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, + 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, + 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, + 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, + 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xd5, 0x01, 0x0a, 0x0e, 0x53, 0x65, 0x72, + 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, + 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, + 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, + 0x75, 0x72, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, + 0x65, 0x64, 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, + 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x58, 0x0a, 0x14, 0x75, + 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, + 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, + 0x22, 0x99, 0x03, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, + 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, + 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x71, 0x0a, 0x11, 0x69, 0x64, 0x65, + 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x5f, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x18, 0x22, + 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70, 0x74, + 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, + 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x3a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, + 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x52, 0x10, 0x69, 0x64, 0x65, 0x6d, + 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x37, 0x0a, 0x08, + 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x23, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, + 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, + 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, + 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, + 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, + 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, + 0x50, 0x0a, 0x10, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, + 0x76, 0x65, 0x6c, 0x12, 0x17, 0x0a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, + 0x43, 0x59, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, + 0x4e, 0x4f, 0x5f, 0x53, 0x49, 0x44, 0x45, 0x5f, 0x45, 0x46, 0x46, 0x45, 0x43, 0x54, 0x53, 0x10, + 0x01, 0x12, 0x0e, 0x0a, 0x0a, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, 0x54, 0x10, + 0x02, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0x9a, 0x03, 0x0a, + 0x13, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, + 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x03, + 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, + 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, + 0x74, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x29, 0x0a, 0x10, 0x69, 0x64, 0x65, 0x6e, 0x74, + 0x69, 0x66, 0x69, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x56, 0x61, 0x6c, + 0x75, 0x65, 0x12, 0x2c, 0x0a, 0x12, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, + 0x6e, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x04, 0x52, 0x10, + 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, + 0x12, 0x2c, 0x0a, 0x12, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, 0x6e, 0x74, + 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52, 0x10, 0x6e, 0x65, + 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, + 0x0a, 0x0c, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x06, + 0x20, 0x01, 0x28, 0x01, 0x52, 0x0b, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, 0x6c, 0x75, + 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, + 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, + 0x61, 0x6c, 0x75, 0x65, 0x12, 0x27, 0x0a, 0x0f, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, + 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x61, + 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0x4a, 0x0a, + 0x08, 0x4e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x6e, 0x61, 0x6d, + 0x65, 0x5f, 0x70, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x02, 0x28, 0x09, 0x52, 0x08, 0x6e, 0x61, + 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x12, 0x21, 0x0a, 0x0c, 0x69, 0x73, 0x5f, 0x65, 0x78, 0x74, + 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x02, 0x28, 0x08, 0x52, 0x0b, 0x69, 0x73, + 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x22, 0xa7, 0x0a, 0x0a, 0x0a, 0x46, 0x65, + 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x12, 0x91, 0x01, 0x0a, 0x0e, 0x66, 0x69, 0x65, + 0x6c, 0x64, 0x5f, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x0e, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x46, + 0x69, 0x65, 0x6c, 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x42, 0x3f, 0x88, 0x01, + 0x01, 0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, 0x58, 0x50, 0x4c, + 0x49, 0x43, 0x49, 0x54, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x49, 0x4d, 0x50, 0x4c, + 0x49, 0x43, 0x49, 0x54, 0x18, 0xe7, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, 0x58, 0x50, 0x4c, + 0x49, 0x43, 0x49, 0x54, 0x18, 0xe8, 0x07, 0xb2, 0x01, 0x03, 0x08, 0xe8, 0x07, 0x52, 0x0d, 0x66, + 0x69, 0x65, 0x6c, 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x6c, 0x0a, 0x09, + 0x65, 0x6e, 0x75, 0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, + 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x45, 0x6e, 0x75, + 0x6d, 0x54, 0x79, 0x70, 0x65, 0x42, 0x29, 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0x98, 0x01, 0x01, + 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x18, 0xe6, 0x07, 0xa2, 0x01, + 0x09, 0x12, 0x04, 0x4f, 0x50, 0x45, 0x4e, 0x18, 0xe7, 0x07, 0xb2, 0x01, 0x03, 0x08, 0xe8, 0x07, + 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, 0x54, 0x79, 0x70, 0x65, 0x12, 0x98, 0x01, 0x0a, 0x17, 0x72, + 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x65, 0x6e, + 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, - 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x54, 0x79, - 0x70, 0x65, 0x42, 0x23, 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0b, - 0x12, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x09, 0x12, 0x04, - 0x4f, 0x50, 0x45, 0x4e, 0x18, 0xe7, 0x07, 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, 0x54, 0x79, 0x70, - 0x65, 0x12, 0x92, 0x01, 0x0a, 0x17, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, - 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x0e, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, - 0x2e, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e, - 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, 0x27, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, 0x01, - 0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, 0x58, 0x50, 0x41, 0x4e, 0x44, 0x45, 0x44, 0x18, 0xe6, - 0x07, 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x50, 0x41, 0x43, 0x4b, 0x45, 0x44, 0x18, 0xe7, 0x07, 0x52, - 0x15, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e, - 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x78, 0x0a, 0x0f, 0x75, 0x74, 0x66, 0x38, 0x5f, 0x76, - 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, - 0x2a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x55, 0x74, 0x66, - 0x38, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x23, 0x88, 0x01, 0x01, - 0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x18, - 0xe6, 0x07, 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x56, 0x45, 0x52, 0x49, 0x46, 0x59, 0x18, 0xe7, 0x07, - 0x52, 0x0e, 0x75, 0x74, 0x66, 0x38, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x12, 0x78, 0x0a, 0x10, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x65, 0x6e, 0x63, 0x6f, - 0x64, 0x69, 0x6e, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, - 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, 0x20, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, - 0x01, 0x01, 0xa2, 0x01, 0x14, 0x12, 0x0f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x5f, 0x50, 0x52, - 0x45, 0x46, 0x49, 0x58, 0x45, 0x44, 0x18, 0xe6, 0x07, 0x52, 0x0f, 0x6d, 0x65, 0x73, 0x73, 0x61, - 0x67, 0x65, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x7c, 0x0a, 0x0b, 0x6a, 0x73, - 0x6f, 0x6e, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, - 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4a, 0x73, 0x6f, - 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x42, 0x33, 0x88, 0x01, 0x01, 0x98, 0x01, 0x03, 0x98, - 0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x17, 0x12, 0x12, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, - 0x5f, 0x42, 0x45, 0x53, 0x54, 0x5f, 0x45, 0x46, 0x46, 0x4f, 0x52, 0x54, 0x18, 0xe6, 0x07, 0xa2, - 0x01, 0x0a, 0x12, 0x05, 0x41, 0x4c, 0x4c, 0x4f, 0x57, 0x18, 0xe7, 0x07, 0x52, 0x0a, 0x6a, 0x73, - 0x6f, 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x22, 0x5c, 0x0a, 0x0d, 0x46, 0x69, 0x65, 0x6c, - 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x1a, 0x0a, 0x16, 0x46, 0x49, 0x45, - 0x4c, 0x44, 0x5f, 0x50, 0x52, 0x45, 0x53, 0x45, 0x4e, 0x43, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, - 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x45, 0x58, 0x50, 0x4c, 0x49, 0x43, 0x49, - 0x54, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x49, 0x4d, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x10, - 0x02, 0x12, 0x13, 0x0a, 0x0f, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x52, 0x45, 0x51, 0x55, - 0x49, 0x52, 0x45, 0x44, 0x10, 0x03, 0x22, 0x37, 0x0a, 0x08, 0x45, 0x6e, 0x75, 0x6d, 0x54, 0x79, - 0x70, 0x65, 0x12, 0x15, 0x0a, 0x11, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x4f, 0x50, 0x45, - 0x4e, 0x10, 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x10, 0x02, 0x22, - 0x56, 0x0a, 0x15, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x23, 0x0a, 0x1f, 0x52, 0x45, 0x50, 0x45, - 0x41, 0x54, 0x45, 0x44, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, - 0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0a, 0x0a, - 0x06, 0x50, 0x41, 0x43, 0x4b, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x45, 0x58, 0x50, - 0x41, 0x4e, 0x44, 0x45, 0x44, 0x10, 0x02, 0x22, 0x43, 0x0a, 0x0e, 0x55, 0x74, 0x66, 0x38, 0x56, - 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x17, 0x55, 0x54, 0x46, - 0x38, 0x5f, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b, - 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x56, 0x45, 0x52, 0x49, 0x46, 0x59, - 0x10, 0x02, 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x10, 0x03, 0x22, 0x53, 0x0a, 0x0f, - 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, - 0x1c, 0x0a, 0x18, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, - 0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, - 0x0f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x45, 0x44, - 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x44, 0x45, 0x4c, 0x49, 0x4d, 0x49, 0x54, 0x45, 0x44, 0x10, - 0x02, 0x22, 0x48, 0x0a, 0x0a, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, - 0x17, 0x0a, 0x13, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x46, 0x4f, 0x52, 0x4d, 0x41, 0x54, 0x5f, 0x55, - 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x4c, 0x4f, - 0x57, 0x10, 0x01, 0x12, 0x16, 0x0a, 0x12, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x42, 0x45, - 0x53, 0x54, 0x5f, 0x45, 0x46, 0x46, 0x4f, 0x52, 0x54, 0x10, 0x02, 0x2a, 0x06, 0x08, 0xe8, 0x07, - 0x10, 0xe9, 0x07, 0x2a, 0x06, 0x08, 0xe9, 0x07, 0x10, 0xea, 0x07, 0x2a, 0x06, 0x08, 0xea, 0x07, - 0x10, 0xeb, 0x07, 0x2a, 0x06, 0x08, 0x8b, 0x4e, 0x10, 0x90, 0x4e, 0x2a, 0x06, 0x08, 0x90, 0x4e, - 0x10, 0x91, 0x4e, 0x4a, 0x06, 0x08, 0xe7, 0x07, 0x10, 0xe8, 0x07, 0x22, 0xfe, 0x02, 0x0a, 0x12, - 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, - 0x74, 0x73, 0x12, 0x58, 0x0a, 0x08, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x18, 0x01, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, - 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, - 0x65, 0x53, 0x65, 0x74, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, - 0x6c, 0x74, 0x52, 0x08, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x12, 0x41, 0x0a, 0x0f, - 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, - 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x0e, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, - 0x41, 0x0a, 0x0f, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x65, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x52, 0x0e, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x45, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x1a, 0x87, 0x01, 0x0a, 0x18, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, - 0x74, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x12, - 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, - 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, - 0x69, 0x6f, 0x6e, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, - 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x22, 0xa7, 0x02, 0x0a, - 0x0e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, - 0x44, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, - 0x0b, 0x32, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, - 0x66, 0x6f, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x6c, 0x6f, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xce, 0x01, 0x0a, 0x08, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, - 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x12, 0x16, 0x0a, 0x04, 0x73, 0x70, - 0x61, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x73, 0x70, - 0x61, 0x6e, 0x12, 0x29, 0x0a, 0x10, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, - 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x6c, 0x65, - 0x61, 0x64, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x2b, 0x0a, - 0x11, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, - 0x74, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, - 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x3a, 0x0a, 0x19, 0x6c, 0x65, - 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x65, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x63, - 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x17, 0x6c, - 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x44, 0x65, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x43, 0x6f, - 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x22, 0xd0, 0x02, 0x0a, 0x11, 0x47, 0x65, 0x6e, 0x65, 0x72, - 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x4d, 0x0a, 0x0a, - 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, - 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, - 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xeb, 0x01, 0x0a, 0x0a, - 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61, - 0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, - 0x74, 0x68, 0x12, 0x1f, 0x0a, 0x0b, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x66, 0x69, 0x6c, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x46, - 0x69, 0x6c, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x05, 0x52, 0x05, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, - 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x12, 0x52, 0x0a, 0x08, 0x73, - 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x36, 0x2e, + 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, + 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, + 0x2d, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, + 0x58, 0x50, 0x41, 0x4e, 0x44, 0x45, 0x44, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x50, + 0x41, 0x43, 0x4b, 0x45, 0x44, 0x18, 0xe7, 0x07, 0xb2, 0x01, 0x03, 0x08, 0xe8, 0x07, 0x52, 0x15, + 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e, 0x63, + 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x7e, 0x0a, 0x0f, 0x75, 0x74, 0x66, 0x38, 0x5f, 0x76, 0x61, + 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2a, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x55, 0x74, 0x66, 0x38, + 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x29, 0x88, 0x01, 0x01, 0x98, + 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x18, 0xe6, + 0x07, 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x56, 0x45, 0x52, 0x49, 0x46, 0x59, 0x18, 0xe7, 0x07, 0xb2, + 0x01, 0x03, 0x08, 0xe8, 0x07, 0x52, 0x0e, 0x75, 0x74, 0x66, 0x38, 0x56, 0x61, 0x6c, 0x69, 0x64, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x7e, 0x0a, 0x10, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, + 0x5f, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, + 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4d, 0x65, 0x73, + 0x73, 0x61, 0x67, 0x65, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, 0x26, 0x88, 0x01, + 0x01, 0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x14, 0x12, 0x0f, 0x4c, 0x45, 0x4e, 0x47, + 0x54, 0x48, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x45, 0x44, 0x18, 0xe6, 0x07, 0xb2, 0x01, + 0x03, 0x08, 0xe8, 0x07, 0x52, 0x0f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, 0x6e, 0x63, + 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x82, 0x01, 0x0a, 0x0b, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, + 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x26, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, + 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x6f, 0x72, + 0x6d, 0x61, 0x74, 0x42, 0x39, 0x88, 0x01, 0x01, 0x98, 0x01, 0x03, 0x98, 0x01, 0x06, 0x98, 0x01, + 0x01, 0xa2, 0x01, 0x17, 0x12, 0x12, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x42, 0x45, 0x53, + 0x54, 0x5f, 0x45, 0x46, 0x46, 0x4f, 0x52, 0x54, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x0a, 0x12, 0x05, + 0x41, 0x4c, 0x4c, 0x4f, 0x57, 0x18, 0xe7, 0x07, 0xb2, 0x01, 0x03, 0x08, 0xe8, 0x07, 0x52, 0x0a, + 0x6a, 0x73, 0x6f, 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x22, 0x5c, 0x0a, 0x0d, 0x46, 0x69, + 0x65, 0x6c, 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x1a, 0x0a, 0x16, 0x46, + 0x49, 0x45, 0x4c, 0x44, 0x5f, 0x50, 0x52, 0x45, 0x53, 0x45, 0x4e, 0x43, 0x45, 0x5f, 0x55, 0x4e, + 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x45, 0x58, 0x50, 0x4c, 0x49, + 0x43, 0x49, 0x54, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x49, 0x4d, 0x50, 0x4c, 0x49, 0x43, 0x49, + 0x54, 0x10, 0x02, 0x12, 0x13, 0x0a, 0x0f, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x52, 0x45, + 0x51, 0x55, 0x49, 0x52, 0x45, 0x44, 0x10, 0x03, 0x22, 0x37, 0x0a, 0x08, 0x45, 0x6e, 0x75, 0x6d, + 0x54, 0x79, 0x70, 0x65, 0x12, 0x15, 0x0a, 0x11, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x54, 0x59, 0x50, + 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x4f, + 0x50, 0x45, 0x4e, 0x10, 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x10, + 0x02, 0x22, 0x56, 0x0a, 0x15, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, + 0x6c, 0x64, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x23, 0x0a, 0x1f, 0x52, 0x45, + 0x50, 0x45, 0x41, 0x54, 0x45, 0x44, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x5f, 0x45, 0x4e, 0x43, + 0x4f, 0x44, 0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, + 0x0a, 0x0a, 0x06, 0x50, 0x41, 0x43, 0x4b, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x45, + 0x58, 0x50, 0x41, 0x4e, 0x44, 0x45, 0x44, 0x10, 0x02, 0x22, 0x49, 0x0a, 0x0e, 0x55, 0x74, 0x66, + 0x38, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x17, 0x55, + 0x54, 0x46, 0x38, 0x5f, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, + 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x56, 0x45, 0x52, 0x49, + 0x46, 0x59, 0x10, 0x02, 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x10, 0x03, 0x22, 0x04, + 0x08, 0x01, 0x10, 0x01, 0x22, 0x53, 0x0a, 0x0f, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, + 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x1c, 0x0a, 0x18, 0x4d, 0x45, 0x53, 0x53, 0x41, + 0x47, 0x45, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, 0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, + 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x5f, + 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x44, 0x45, + 0x4c, 0x49, 0x4d, 0x49, 0x54, 0x45, 0x44, 0x10, 0x02, 0x22, 0x48, 0x0a, 0x0a, 0x4a, 0x73, 0x6f, + 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, 0x17, 0x0a, 0x13, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, + 0x46, 0x4f, 0x52, 0x4d, 0x41, 0x54, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, + 0x12, 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x4c, 0x4f, 0x57, 0x10, 0x01, 0x12, 0x16, 0x0a, 0x12, 0x4c, + 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x42, 0x45, 0x53, 0x54, 0x5f, 0x45, 0x46, 0x46, 0x4f, 0x52, + 0x54, 0x10, 0x02, 0x2a, 0x06, 0x08, 0xe8, 0x07, 0x10, 0x8b, 0x4e, 0x2a, 0x06, 0x08, 0x8b, 0x4e, + 0x10, 0x90, 0x4e, 0x2a, 0x06, 0x08, 0x90, 0x4e, 0x10, 0x91, 0x4e, 0x4a, 0x06, 0x08, 0xe7, 0x07, + 0x10, 0xe8, 0x07, 0x22, 0xef, 0x03, 0x0a, 0x12, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, + 0x65, 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x12, 0x58, 0x0a, 0x08, 0x64, 0x65, + 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3c, 0x2e, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, + 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, + 0x73, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x45, 0x64, 0x69, 0x74, + 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x52, 0x08, 0x64, 0x65, 0x66, 0x61, + 0x75, 0x6c, 0x74, 0x73, 0x12, 0x41, 0x0a, 0x0f, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x5f, + 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, - 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x6d, - 0x61, 0x6e, 0x74, 0x69, 0x63, 0x52, 0x08, 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x22, - 0x28, 0x0a, 0x08, 0x53, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x12, 0x08, 0x0a, 0x04, 0x4e, - 0x4f, 0x4e, 0x45, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x53, 0x45, 0x54, 0x10, 0x01, 0x12, 0x09, - 0x0a, 0x05, 0x41, 0x4c, 0x49, 0x41, 0x53, 0x10, 0x02, 0x2a, 0x92, 0x02, 0x0a, 0x07, 0x45, 0x64, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x13, 0x0a, 0x0f, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, - 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0e, 0x45, 0x44, - 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x32, 0x10, 0xe6, 0x07, 0x12, - 0x13, 0x0a, 0x0e, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, - 0x33, 0x10, 0xe7, 0x07, 0x12, 0x11, 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, - 0x32, 0x30, 0x32, 0x33, 0x10, 0xe8, 0x07, 0x12, 0x11, 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49, - 0x4f, 0x4e, 0x5f, 0x32, 0x30, 0x32, 0x34, 0x10, 0xe9, 0x07, 0x12, 0x17, 0x0a, 0x13, 0x45, 0x44, - 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x31, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, - 0x59, 0x10, 0x01, 0x12, 0x17, 0x0a, 0x13, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x32, - 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x02, 0x12, 0x1d, 0x0a, 0x17, - 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x37, 0x5f, 0x54, 0x45, - 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9d, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45, - 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x38, 0x5f, 0x54, 0x45, 0x53, - 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9e, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45, 0x44, - 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x39, 0x5f, 0x54, 0x45, 0x53, 0x54, - 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9f, 0x8d, 0x06, 0x12, 0x13, 0x0a, 0x0b, 0x45, 0x44, 0x49, - 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, 0x41, 0x58, 0x10, 0xff, 0xff, 0xff, 0xff, 0x07, 0x42, 0x7e, - 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x10, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x73, 0x48, 0x01, 0x5a, 0x2d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x64, 0x65, 0x73, 0x63, - 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x03, 0x47, 0x50, - 0x42, 0xaa, 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x52, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, + 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0e, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, + 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x0f, 0x6d, 0x61, 0x78, 0x69, 0x6d, + 0x75, 0x6d, 0x5f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, + 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, + 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0e, 0x6d, 0x61, 0x78, 0x69, + 0x6d, 0x75, 0x6d, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xf8, 0x01, 0x0a, 0x18, 0x46, + 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, + 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4e, 0x0a, 0x14, 0x6f, + 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x61, 0x62, 0x6c, 0x65, 0x5f, 0x66, 0x65, 0x61, 0x74, 0x75, + 0x72, 0x65, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, + 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x13, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x61, + 0x62, 0x6c, 0x65, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x42, 0x0a, 0x0e, 0x66, + 0x69, 0x78, 0x65, 0x64, 0x5f, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x05, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, + 0x52, 0x0d, 0x66, 0x69, 0x78, 0x65, 0x64, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x4a, + 0x04, 0x08, 0x01, 0x10, 0x02, 0x4a, 0x04, 0x08, 0x02, 0x10, 0x03, 0x52, 0x08, 0x66, 0x65, 0x61, + 0x74, 0x75, 0x72, 0x65, 0x73, 0x22, 0xa7, 0x02, 0x0a, 0x0e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x44, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x28, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x4c, 0x6f, 0x63, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xce, + 0x01, 0x0a, 0x08, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, + 0x61, 0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, + 0x61, 0x74, 0x68, 0x12, 0x16, 0x0a, 0x04, 0x73, 0x70, 0x61, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, + 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x73, 0x70, 0x61, 0x6e, 0x12, 0x29, 0x0a, 0x10, 0x6c, + 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, + 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x43, 0x6f, + 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x12, 0x2b, 0x0a, 0x11, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, + 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x10, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, + 0x6e, 0x74, 0x73, 0x12, 0x3a, 0x0a, 0x19, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x64, + 0x65, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, + 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x17, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x44, + 0x65, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x22, + 0xd0, 0x02, 0x0a, 0x11, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, + 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x4d, 0x0a, 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, + 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, + 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, + 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xeb, 0x01, 0x0a, 0x0a, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, + 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x12, 0x1f, 0x0a, 0x0b, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x66, 0x69, 0x6c, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x0a, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x46, 0x69, 0x6c, 0x65, 0x12, 0x14, 0x0a, 0x05, + 0x62, 0x65, 0x67, 0x69, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x62, 0x65, 0x67, + 0x69, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, + 0x03, 0x65, 0x6e, 0x64, 0x12, 0x52, 0x0a, 0x08, 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, + 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, + 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x53, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x52, 0x08, + 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x22, 0x28, 0x0a, 0x08, 0x53, 0x65, 0x6d, 0x61, + 0x6e, 0x74, 0x69, 0x63, 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x10, 0x00, 0x12, 0x07, + 0x0a, 0x03, 0x53, 0x45, 0x54, 0x10, 0x01, 0x12, 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x49, 0x41, 0x53, + 0x10, 0x02, 0x2a, 0xa7, 0x02, 0x0a, 0x07, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x13, + 0x0a, 0x0f, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, + 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0e, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4c, + 0x45, 0x47, 0x41, 0x43, 0x59, 0x10, 0x84, 0x07, 0x12, 0x13, 0x0a, 0x0e, 0x45, 0x44, 0x49, 0x54, + 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x32, 0x10, 0xe6, 0x07, 0x12, 0x13, 0x0a, + 0x0e, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x33, 0x10, + 0xe7, 0x07, 0x12, 0x11, 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x32, 0x30, + 0x32, 0x33, 0x10, 0xe8, 0x07, 0x12, 0x11, 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, + 0x5f, 0x32, 0x30, 0x32, 0x34, 0x10, 0xe9, 0x07, 0x12, 0x17, 0x0a, 0x13, 0x45, 0x44, 0x49, 0x54, + 0x49, 0x4f, 0x4e, 0x5f, 0x31, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, + 0x01, 0x12, 0x17, 0x0a, 0x13, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x32, 0x5f, 0x54, + 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x02, 0x12, 0x1d, 0x0a, 0x17, 0x45, 0x44, + 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x37, 0x5f, 0x54, 0x45, 0x53, 0x54, + 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9d, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45, 0x44, 0x49, + 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x38, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, + 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x9e, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45, 0x44, 0x49, 0x54, + 0x49, 0x4f, 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x39, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, + 0x4e, 0x4c, 0x59, 0x10, 0x9f, 0x8d, 0x06, 0x12, 0x13, 0x0a, 0x0b, 0x45, 0x44, 0x49, 0x54, 0x49, + 0x4f, 0x4e, 0x5f, 0x4d, 0x41, 0x58, 0x10, 0xff, 0xff, 0xff, 0xff, 0x07, 0x42, 0x7e, 0x0a, 0x13, + 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x42, 0x10, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, + 0x72, 0x6f, 0x74, 0x6f, 0x73, 0x48, 0x01, 0x5a, 0x2d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, + 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x6f, 0x72, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x03, 0x47, 0x50, 0x42, 0xaa, + 0x02, 0x1a, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x52, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, } var ( @@ -5084,8 +5242,8 @@ func file_google_protobuf_descriptor_proto_rawDescGZIP() []byte { } var file_google_protobuf_descriptor_proto_enumTypes = make([]protoimpl.EnumInfo, 17) -var file_google_protobuf_descriptor_proto_msgTypes = make([]protoimpl.MessageInfo, 32) -var file_google_protobuf_descriptor_proto_goTypes = []interface{}{ +var file_google_protobuf_descriptor_proto_msgTypes = make([]protoimpl.MessageInfo, 33) +var file_google_protobuf_descriptor_proto_goTypes = []any{ (Edition)(0), // 0: google.protobuf.Edition (ExtensionRangeOptions_VerificationState)(0), // 1: google.protobuf.ExtensionRangeOptions.VerificationState (FieldDescriptorProto_Type)(0), // 2: google.protobuf.FieldDescriptorProto.Type @@ -5131,10 +5289,11 @@ var file_google_protobuf_descriptor_proto_goTypes = []interface{}{ (*ExtensionRangeOptions_Declaration)(nil), // 42: google.protobuf.ExtensionRangeOptions.Declaration (*EnumDescriptorProto_EnumReservedRange)(nil), // 43: google.protobuf.EnumDescriptorProto.EnumReservedRange (*FieldOptions_EditionDefault)(nil), // 44: google.protobuf.FieldOptions.EditionDefault - (*UninterpretedOption_NamePart)(nil), // 45: google.protobuf.UninterpretedOption.NamePart - (*FeatureSetDefaults_FeatureSetEditionDefault)(nil), // 46: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault - (*SourceCodeInfo_Location)(nil), // 47: google.protobuf.SourceCodeInfo.Location - (*GeneratedCodeInfo_Annotation)(nil), // 48: google.protobuf.GeneratedCodeInfo.Annotation + (*FieldOptions_FeatureSupport)(nil), // 45: google.protobuf.FieldOptions.FeatureSupport + (*UninterpretedOption_NamePart)(nil), // 46: google.protobuf.UninterpretedOption.NamePart + (*FeatureSetDefaults_FeatureSetEditionDefault)(nil), // 47: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault + (*SourceCodeInfo_Location)(nil), // 48: google.protobuf.SourceCodeInfo.Location + (*GeneratedCodeInfo_Annotation)(nil), // 49: google.protobuf.GeneratedCodeInfo.Annotation } var file_google_protobuf_descriptor_proto_depIdxs = []int32{ 18, // 0: google.protobuf.FileDescriptorSet.file:type_name -> google.protobuf.FileDescriptorProto @@ -5179,40 +5338,46 @@ var file_google_protobuf_descriptor_proto_depIdxs = []int32{ 8, // 39: google.protobuf.FieldOptions.targets:type_name -> google.protobuf.FieldOptions.OptionTargetType 44, // 40: google.protobuf.FieldOptions.edition_defaults:type_name -> google.protobuf.FieldOptions.EditionDefault 36, // 41: google.protobuf.FieldOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 42: google.protobuf.FieldOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 36, // 43: google.protobuf.OneofOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 44: google.protobuf.OneofOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 36, // 45: google.protobuf.EnumOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 46: google.protobuf.EnumOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 36, // 47: google.protobuf.EnumValueOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 48: google.protobuf.EnumValueOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 36, // 49: google.protobuf.ServiceOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 50: google.protobuf.ServiceOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 9, // 51: google.protobuf.MethodOptions.idempotency_level:type_name -> google.protobuf.MethodOptions.IdempotencyLevel - 36, // 52: google.protobuf.MethodOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 53: google.protobuf.MethodOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 45, // 54: google.protobuf.UninterpretedOption.name:type_name -> google.protobuf.UninterpretedOption.NamePart - 10, // 55: google.protobuf.FeatureSet.field_presence:type_name -> google.protobuf.FeatureSet.FieldPresence - 11, // 56: google.protobuf.FeatureSet.enum_type:type_name -> google.protobuf.FeatureSet.EnumType - 12, // 57: google.protobuf.FeatureSet.repeated_field_encoding:type_name -> google.protobuf.FeatureSet.RepeatedFieldEncoding - 13, // 58: google.protobuf.FeatureSet.utf8_validation:type_name -> google.protobuf.FeatureSet.Utf8Validation - 14, // 59: google.protobuf.FeatureSet.message_encoding:type_name -> google.protobuf.FeatureSet.MessageEncoding - 15, // 60: google.protobuf.FeatureSet.json_format:type_name -> google.protobuf.FeatureSet.JsonFormat - 46, // 61: google.protobuf.FeatureSetDefaults.defaults:type_name -> google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault - 0, // 62: google.protobuf.FeatureSetDefaults.minimum_edition:type_name -> google.protobuf.Edition - 0, // 63: google.protobuf.FeatureSetDefaults.maximum_edition:type_name -> google.protobuf.Edition - 47, // 64: google.protobuf.SourceCodeInfo.location:type_name -> google.protobuf.SourceCodeInfo.Location - 48, // 65: google.protobuf.GeneratedCodeInfo.annotation:type_name -> google.protobuf.GeneratedCodeInfo.Annotation - 20, // 66: google.protobuf.DescriptorProto.ExtensionRange.options:type_name -> google.protobuf.ExtensionRangeOptions - 0, // 67: google.protobuf.FieldOptions.EditionDefault.edition:type_name -> google.protobuf.Edition - 0, // 68: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition:type_name -> google.protobuf.Edition - 36, // 69: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.features:type_name -> google.protobuf.FeatureSet - 16, // 70: google.protobuf.GeneratedCodeInfo.Annotation.semantic:type_name -> google.protobuf.GeneratedCodeInfo.Annotation.Semantic - 71, // [71:71] is the sub-list for method output_type - 71, // [71:71] is the sub-list for method input_type - 71, // [71:71] is the sub-list for extension type_name - 71, // [71:71] is the sub-list for extension extendee - 0, // [0:71] is the sub-list for field type_name + 45, // 42: google.protobuf.FieldOptions.feature_support:type_name -> google.protobuf.FieldOptions.FeatureSupport + 35, // 43: google.protobuf.FieldOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 36, // 44: google.protobuf.OneofOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 45: google.protobuf.OneofOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 36, // 46: google.protobuf.EnumOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 47: google.protobuf.EnumOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 36, // 48: google.protobuf.EnumValueOptions.features:type_name -> google.protobuf.FeatureSet + 45, // 49: google.protobuf.EnumValueOptions.feature_support:type_name -> google.protobuf.FieldOptions.FeatureSupport + 35, // 50: google.protobuf.EnumValueOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 36, // 51: google.protobuf.ServiceOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 52: google.protobuf.ServiceOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 9, // 53: google.protobuf.MethodOptions.idempotency_level:type_name -> google.protobuf.MethodOptions.IdempotencyLevel + 36, // 54: google.protobuf.MethodOptions.features:type_name -> google.protobuf.FeatureSet + 35, // 55: google.protobuf.MethodOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 46, // 56: google.protobuf.UninterpretedOption.name:type_name -> google.protobuf.UninterpretedOption.NamePart + 10, // 57: google.protobuf.FeatureSet.field_presence:type_name -> google.protobuf.FeatureSet.FieldPresence + 11, // 58: google.protobuf.FeatureSet.enum_type:type_name -> google.protobuf.FeatureSet.EnumType + 12, // 59: google.protobuf.FeatureSet.repeated_field_encoding:type_name -> google.protobuf.FeatureSet.RepeatedFieldEncoding + 13, // 60: google.protobuf.FeatureSet.utf8_validation:type_name -> google.protobuf.FeatureSet.Utf8Validation + 14, // 61: google.protobuf.FeatureSet.message_encoding:type_name -> google.protobuf.FeatureSet.MessageEncoding + 15, // 62: google.protobuf.FeatureSet.json_format:type_name -> google.protobuf.FeatureSet.JsonFormat + 47, // 63: google.protobuf.FeatureSetDefaults.defaults:type_name -> google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault + 0, // 64: google.protobuf.FeatureSetDefaults.minimum_edition:type_name -> google.protobuf.Edition + 0, // 65: google.protobuf.FeatureSetDefaults.maximum_edition:type_name -> google.protobuf.Edition + 48, // 66: google.protobuf.SourceCodeInfo.location:type_name -> google.protobuf.SourceCodeInfo.Location + 49, // 67: google.protobuf.GeneratedCodeInfo.annotation:type_name -> google.protobuf.GeneratedCodeInfo.Annotation + 20, // 68: google.protobuf.DescriptorProto.ExtensionRange.options:type_name -> google.protobuf.ExtensionRangeOptions + 0, // 69: google.protobuf.FieldOptions.EditionDefault.edition:type_name -> google.protobuf.Edition + 0, // 70: google.protobuf.FieldOptions.FeatureSupport.edition_introduced:type_name -> google.protobuf.Edition + 0, // 71: google.protobuf.FieldOptions.FeatureSupport.edition_deprecated:type_name -> google.protobuf.Edition + 0, // 72: google.protobuf.FieldOptions.FeatureSupport.edition_removed:type_name -> google.protobuf.Edition + 0, // 73: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition:type_name -> google.protobuf.Edition + 36, // 74: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.overridable_features:type_name -> google.protobuf.FeatureSet + 36, // 75: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.fixed_features:type_name -> google.protobuf.FeatureSet + 16, // 76: google.protobuf.GeneratedCodeInfo.Annotation.semantic:type_name -> google.protobuf.GeneratedCodeInfo.Annotation.Semantic + 77, // [77:77] is the sub-list for method output_type + 77, // [77:77] is the sub-list for method input_type + 77, // [77:77] is the sub-list for extension type_name + 77, // [77:77] is the sub-list for extension extendee + 0, // [0:77] is the sub-list for field type_name } func init() { file_google_protobuf_descriptor_proto_init() } @@ -5221,7 +5386,7 @@ func file_google_protobuf_descriptor_proto_init() { return } if !protoimpl.UnsafeEnabled { - file_google_protobuf_descriptor_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[0].Exporter = func(v any, i int) any { switch v := v.(*FileDescriptorSet); i { case 0: return &v.state @@ -5233,7 +5398,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[1].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[1].Exporter = func(v any, i int) any { switch v := v.(*FileDescriptorProto); i { case 0: return &v.state @@ -5245,7 +5410,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[2].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[2].Exporter = func(v any, i int) any { switch v := v.(*DescriptorProto); i { case 0: return &v.state @@ -5257,7 +5422,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[3].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[3].Exporter = func(v any, i int) any { switch v := v.(*ExtensionRangeOptions); i { case 0: return &v.state @@ -5271,7 +5436,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[4].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[4].Exporter = func(v any, i int) any { switch v := v.(*FieldDescriptorProto); i { case 0: return &v.state @@ -5283,7 +5448,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[5].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[5].Exporter = func(v any, i int) any { switch v := v.(*OneofDescriptorProto); i { case 0: return &v.state @@ -5295,7 +5460,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[6].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[6].Exporter = func(v any, i int) any { switch v := v.(*EnumDescriptorProto); i { case 0: return &v.state @@ -5307,7 +5472,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[7].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[7].Exporter = func(v any, i int) any { switch v := v.(*EnumValueDescriptorProto); i { case 0: return &v.state @@ -5319,7 +5484,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[8].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[8].Exporter = func(v any, i int) any { switch v := v.(*ServiceDescriptorProto); i { case 0: return &v.state @@ -5331,7 +5496,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[9].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[9].Exporter = func(v any, i int) any { switch v := v.(*MethodDescriptorProto); i { case 0: return &v.state @@ -5343,7 +5508,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[10].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[10].Exporter = func(v any, i int) any { switch v := v.(*FileOptions); i { case 0: return &v.state @@ -5357,7 +5522,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[11].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[11].Exporter = func(v any, i int) any { switch v := v.(*MessageOptions); i { case 0: return &v.state @@ -5371,7 +5536,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[12].Exporter = func(v any, i int) any { switch v := v.(*FieldOptions); i { case 0: return &v.state @@ -5385,7 +5550,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[13].Exporter = func(v any, i int) any { switch v := v.(*OneofOptions); i { case 0: return &v.state @@ -5399,7 +5564,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[14].Exporter = func(v any, i int) any { switch v := v.(*EnumOptions); i { case 0: return &v.state @@ -5413,7 +5578,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[15].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[15].Exporter = func(v any, i int) any { switch v := v.(*EnumValueOptions); i { case 0: return &v.state @@ -5427,7 +5592,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[16].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[16].Exporter = func(v any, i int) any { switch v := v.(*ServiceOptions); i { case 0: return &v.state @@ -5441,7 +5606,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[17].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[17].Exporter = func(v any, i int) any { switch v := v.(*MethodOptions); i { case 0: return &v.state @@ -5455,7 +5620,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[18].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[18].Exporter = func(v any, i int) any { switch v := v.(*UninterpretedOption); i { case 0: return &v.state @@ -5467,7 +5632,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[19].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[19].Exporter = func(v any, i int) any { switch v := v.(*FeatureSet); i { case 0: return &v.state @@ -5481,7 +5646,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[20].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[20].Exporter = func(v any, i int) any { switch v := v.(*FeatureSetDefaults); i { case 0: return &v.state @@ -5493,7 +5658,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[21].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[21].Exporter = func(v any, i int) any { switch v := v.(*SourceCodeInfo); i { case 0: return &v.state @@ -5505,7 +5670,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[22].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[22].Exporter = func(v any, i int) any { switch v := v.(*GeneratedCodeInfo); i { case 0: return &v.state @@ -5517,7 +5682,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[23].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[23].Exporter = func(v any, i int) any { switch v := v.(*DescriptorProto_ExtensionRange); i { case 0: return &v.state @@ -5529,7 +5694,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[24].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[24].Exporter = func(v any, i int) any { switch v := v.(*DescriptorProto_ReservedRange); i { case 0: return &v.state @@ -5541,7 +5706,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[25].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[25].Exporter = func(v any, i int) any { switch v := v.(*ExtensionRangeOptions_Declaration); i { case 0: return &v.state @@ -5553,7 +5718,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[26].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[26].Exporter = func(v any, i int) any { switch v := v.(*EnumDescriptorProto_EnumReservedRange); i { case 0: return &v.state @@ -5565,7 +5730,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[27].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[27].Exporter = func(v any, i int) any { switch v := v.(*FieldOptions_EditionDefault); i { case 0: return &v.state @@ -5577,7 +5742,19 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[28].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[28].Exporter = func(v any, i int) any { + switch v := v.(*FieldOptions_FeatureSupport); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_google_protobuf_descriptor_proto_msgTypes[29].Exporter = func(v any, i int) any { switch v := v.(*UninterpretedOption_NamePart); i { case 0: return &v.state @@ -5589,7 +5766,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[29].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[30].Exporter = func(v any, i int) any { switch v := v.(*FeatureSetDefaults_FeatureSetEditionDefault); i { case 0: return &v.state @@ -5601,7 +5778,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[30].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[31].Exporter = func(v any, i int) any { switch v := v.(*SourceCodeInfo_Location); i { case 0: return &v.state @@ -5613,7 +5790,7 @@ func file_google_protobuf_descriptor_proto_init() { return nil } } - file_google_protobuf_descriptor_proto_msgTypes[31].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_descriptor_proto_msgTypes[32].Exporter = func(v any, i int) any { switch v := v.(*GeneratedCodeInfo_Annotation); i { case 0: return &v.state @@ -5632,7 +5809,7 @@ func file_google_protobuf_descriptor_proto_init() { GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_protobuf_descriptor_proto_rawDesc, NumEnums: 17, - NumMessages: 32, + NumMessages: 33, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/google.golang.org/protobuf/types/dynamicpb/dynamic.go b/vendor/google.golang.org/protobuf/types/dynamicpb/dynamic.go index 39b024b4..1ba1dfa5 100644 --- a/vendor/google.golang.org/protobuf/types/dynamicpb/dynamic.go +++ b/vendor/google.golang.org/protobuf/types/dynamicpb/dynamic.go @@ -294,7 +294,7 @@ func (m *Message) NewField(fd protoreflect.FieldDescriptor) protoreflect.Value { case fd.IsMap(): return protoreflect.ValueOfMap(&dynamicMap{ desc: fd, - mapv: make(map[interface{}]protoreflect.Value), + mapv: make(map[any]protoreflect.Value), }) case fd.IsList(): return protoreflect.ValueOfList(&dynamicList{desc: fd}) @@ -450,7 +450,7 @@ func (x *dynamicList) IsValid() bool { type dynamicMap struct { desc protoreflect.FieldDescriptor - mapv map[interface{}]protoreflect.Value + mapv map[any]protoreflect.Value } func (x *dynamicMap) Get(k protoreflect.MapKey) protoreflect.Value { return x.mapv[k.Interface()] } @@ -634,11 +634,11 @@ func newListEntry(fd protoreflect.FieldDescriptor) protoreflect.Value { // // The InterfaceOf and ValueOf methods of the extension type are defined as: // -// func (xt extensionType) ValueOf(iv interface{}) protoreflect.Value { +// func (xt extensionType) ValueOf(iv any) protoreflect.Value { // return protoreflect.ValueOf(iv) // } // -// func (xt extensionType) InterfaceOf(v protoreflect.Value) interface{} { +// func (xt extensionType) InterfaceOf(v protoreflect.Value) any { // return v.Interface() // } // @@ -658,7 +658,7 @@ func (xt extensionType) New() protoreflect.Value { case xt.desc.IsMap(): return protoreflect.ValueOfMap(&dynamicMap{ desc: xt.desc, - mapv: make(map[interface{}]protoreflect.Value), + mapv: make(map[any]protoreflect.Value), }) case xt.desc.IsList(): return protoreflect.ValueOfList(&dynamicList{desc: xt.desc}) @@ -686,18 +686,18 @@ func (xt extensionType) TypeDescriptor() protoreflect.ExtensionTypeDescriptor { return xt.desc } -func (xt extensionType) ValueOf(iv interface{}) protoreflect.Value { +func (xt extensionType) ValueOf(iv any) protoreflect.Value { v := protoreflect.ValueOf(iv) typecheck(xt.desc, v) return v } -func (xt extensionType) InterfaceOf(v protoreflect.Value) interface{} { +func (xt extensionType) InterfaceOf(v protoreflect.Value) any { typecheck(xt.desc, v) return v.Interface() } -func (xt extensionType) IsValidInterface(iv interface{}) bool { +func (xt extensionType) IsValidInterface(iv any) bool { return typeIsValid(xt.desc, protoreflect.ValueOf(iv)) == nil } diff --git a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go index 25de5ae0..a2ca940c 100644 --- a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go +++ b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go @@ -6,9 +6,9 @@ // https://developers.google.com/open-source/licenses/bsd // Code generated by protoc-gen-go. DO NOT EDIT. -// source: reflect/protodesc/proto/go_features.proto +// source: google/protobuf/go_features.proto -package proto +package gofeaturespb import ( protoreflect "google.golang.org/protobuf/reflect/protoreflect" @@ -30,7 +30,7 @@ type GoFeatures struct { func (x *GoFeatures) Reset() { *x = GoFeatures{} if protoimpl.UnsafeEnabled { - mi := &file_reflect_protodesc_proto_go_features_proto_msgTypes[0] + mi := &file_google_protobuf_go_features_proto_msgTypes[0] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -43,7 +43,7 @@ func (x *GoFeatures) String() string { func (*GoFeatures) ProtoMessage() {} func (x *GoFeatures) ProtoReflect() protoreflect.Message { - mi := &file_reflect_protodesc_proto_go_features_proto_msgTypes[0] + mi := &file_google_protobuf_go_features_proto_msgTypes[0] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -56,7 +56,7 @@ func (x *GoFeatures) ProtoReflect() protoreflect.Message { // Deprecated: Use GoFeatures.ProtoReflect.Descriptor instead. func (*GoFeatures) Descriptor() ([]byte, []int) { - return file_reflect_protodesc_proto_go_features_proto_rawDescGZIP(), []int{0} + return file_google_protobuf_go_features_proto_rawDescGZIP(), []int{0} } func (x *GoFeatures) GetLegacyUnmarshalJsonEnum() bool { @@ -66,69 +66,73 @@ func (x *GoFeatures) GetLegacyUnmarshalJsonEnum() bool { return false } -var file_reflect_protodesc_proto_go_features_proto_extTypes = []protoimpl.ExtensionInfo{ +var file_google_protobuf_go_features_proto_extTypes = []protoimpl.ExtensionInfo{ { ExtendedType: (*descriptorpb.FeatureSet)(nil), ExtensionType: (*GoFeatures)(nil), Field: 1002, - Name: "google.protobuf.go", + Name: "pb.go", Tag: "bytes,1002,opt,name=go", - Filename: "reflect/protodesc/proto/go_features.proto", + Filename: "google/protobuf/go_features.proto", }, } // Extension fields to descriptorpb.FeatureSet. var ( - // optional google.protobuf.GoFeatures go = 1002; - E_Go = &file_reflect_protodesc_proto_go_features_proto_extTypes[0] + // optional pb.GoFeatures go = 1002; + E_Go = &file_google_protobuf_go_features_proto_extTypes[0] ) -var File_reflect_protodesc_proto_go_features_proto protoreflect.FileDescriptor - -var file_reflect_protodesc_proto_go_features_proto_rawDesc = []byte{ - 0x0a, 0x29, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x64, - 0x65, 0x73, 0x63, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x5f, 0x66, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x0f, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x1a, 0x20, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0x6a, - 0x0a, 0x0a, 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x5c, 0x0a, 0x1a, - 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x75, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, 0x61, 0x6c, - 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x65, 0x6e, 0x75, 0x6d, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, - 0x42, 0x1f, 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x74, 0x72, 0x75, - 0x65, 0x18, 0xe6, 0x07, 0xa2, 0x01, 0x0a, 0x12, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x18, 0xe7, - 0x07, 0x52, 0x17, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x55, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, - 0x61, 0x6c, 0x4a, 0x73, 0x6f, 0x6e, 0x45, 0x6e, 0x75, 0x6d, 0x3a, 0x49, 0x0a, 0x02, 0x67, 0x6f, - 0x12, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x18, 0xea, 0x07, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x73, 0x52, 0x02, 0x67, 0x6f, 0x42, 0x34, 0x5a, 0x32, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2f, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x2f, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x64, 0x65, 0x73, 0x63, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, +var File_google_protobuf_go_features_proto protoreflect.FileDescriptor + +var file_google_protobuf_go_features_proto_rawDesc = []byte{ + 0x0a, 0x21, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2f, 0x67, 0x6f, 0x5f, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x2e, 0x70, 0x72, + 0x6f, 0x74, 0x6f, 0x12, 0x02, 0x70, 0x62, 0x1a, 0x20, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, + 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, + 0x74, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xcd, 0x01, 0x0a, 0x0a, 0x47, 0x6f, + 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0xbe, 0x01, 0x0a, 0x1a, 0x6c, 0x65, 0x67, + 0x61, 0x63, 0x79, 0x5f, 0x75, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, 0x61, 0x6c, 0x5f, 0x6a, 0x73, + 0x6f, 0x6e, 0x5f, 0x65, 0x6e, 0x75, 0x6d, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x42, 0x80, 0x01, + 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x74, 0x72, + 0x75, 0x65, 0x18, 0x84, 0x07, 0xa2, 0x01, 0x0a, 0x12, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x18, + 0xe7, 0x07, 0xb2, 0x01, 0x5b, 0x08, 0xe8, 0x07, 0x10, 0xe8, 0x07, 0x1a, 0x53, 0x54, 0x68, 0x65, + 0x20, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x20, 0x55, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, 0x61, + 0x6c, 0x4a, 0x53, 0x4f, 0x4e, 0x20, 0x41, 0x50, 0x49, 0x20, 0x69, 0x73, 0x20, 0x64, 0x65, 0x70, + 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x77, 0x69, 0x6c, 0x6c, + 0x20, 0x62, 0x65, 0x20, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x61, + 0x20, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x20, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, + 0x52, 0x17, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x55, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, 0x61, + 0x6c, 0x4a, 0x73, 0x6f, 0x6e, 0x45, 0x6e, 0x75, 0x6d, 0x3a, 0x3c, 0x0a, 0x02, 0x67, 0x6f, 0x12, + 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, + 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x18, 0xea, 0x07, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x0e, 0x2e, 0x70, 0x62, 0x2e, 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, + 0x72, 0x65, 0x73, 0x52, 0x02, 0x67, 0x6f, 0x42, 0x2f, 0x5a, 0x2d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, + 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x67, 0x6f, 0x66, 0x65, + 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x70, 0x62, } var ( - file_reflect_protodesc_proto_go_features_proto_rawDescOnce sync.Once - file_reflect_protodesc_proto_go_features_proto_rawDescData = file_reflect_protodesc_proto_go_features_proto_rawDesc + file_google_protobuf_go_features_proto_rawDescOnce sync.Once + file_google_protobuf_go_features_proto_rawDescData = file_google_protobuf_go_features_proto_rawDesc ) -func file_reflect_protodesc_proto_go_features_proto_rawDescGZIP() []byte { - file_reflect_protodesc_proto_go_features_proto_rawDescOnce.Do(func() { - file_reflect_protodesc_proto_go_features_proto_rawDescData = protoimpl.X.CompressGZIP(file_reflect_protodesc_proto_go_features_proto_rawDescData) +func file_google_protobuf_go_features_proto_rawDescGZIP() []byte { + file_google_protobuf_go_features_proto_rawDescOnce.Do(func() { + file_google_protobuf_go_features_proto_rawDescData = protoimpl.X.CompressGZIP(file_google_protobuf_go_features_proto_rawDescData) }) - return file_reflect_protodesc_proto_go_features_proto_rawDescData + return file_google_protobuf_go_features_proto_rawDescData } -var file_reflect_protodesc_proto_go_features_proto_msgTypes = make([]protoimpl.MessageInfo, 1) -var file_reflect_protodesc_proto_go_features_proto_goTypes = []interface{}{ - (*GoFeatures)(nil), // 0: google.protobuf.GoFeatures +var file_google_protobuf_go_features_proto_msgTypes = make([]protoimpl.MessageInfo, 1) +var file_google_protobuf_go_features_proto_goTypes = []any{ + (*GoFeatures)(nil), // 0: pb.GoFeatures (*descriptorpb.FeatureSet)(nil), // 1: google.protobuf.FeatureSet } -var file_reflect_protodesc_proto_go_features_proto_depIdxs = []int32{ - 1, // 0: google.protobuf.go:extendee -> google.protobuf.FeatureSet - 0, // 1: google.protobuf.go:type_name -> google.protobuf.GoFeatures +var file_google_protobuf_go_features_proto_depIdxs = []int32{ + 1, // 0: pb.go:extendee -> google.protobuf.FeatureSet + 0, // 1: pb.go:type_name -> pb.GoFeatures 2, // [2:2] is the sub-list for method output_type 2, // [2:2] is the sub-list for method input_type 1, // [1:2] is the sub-list for extension type_name @@ -136,13 +140,13 @@ var file_reflect_protodesc_proto_go_features_proto_depIdxs = []int32{ 0, // [0:0] is the sub-list for field type_name } -func init() { file_reflect_protodesc_proto_go_features_proto_init() } -func file_reflect_protodesc_proto_go_features_proto_init() { - if File_reflect_protodesc_proto_go_features_proto != nil { +func init() { file_google_protobuf_go_features_proto_init() } +func file_google_protobuf_go_features_proto_init() { + if File_google_protobuf_go_features_proto != nil { return } if !protoimpl.UnsafeEnabled { - file_reflect_protodesc_proto_go_features_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_go_features_proto_msgTypes[0].Exporter = func(v any, i int) any { switch v := v.(*GoFeatures); i { case 0: return &v.state @@ -159,19 +163,19 @@ func file_reflect_protodesc_proto_go_features_proto_init() { out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), - RawDescriptor: file_reflect_protodesc_proto_go_features_proto_rawDesc, + RawDescriptor: file_google_protobuf_go_features_proto_rawDesc, NumEnums: 0, NumMessages: 1, NumExtensions: 1, NumServices: 0, }, - GoTypes: file_reflect_protodesc_proto_go_features_proto_goTypes, - DependencyIndexes: file_reflect_protodesc_proto_go_features_proto_depIdxs, - MessageInfos: file_reflect_protodesc_proto_go_features_proto_msgTypes, - ExtensionInfos: file_reflect_protodesc_proto_go_features_proto_extTypes, + GoTypes: file_google_protobuf_go_features_proto_goTypes, + DependencyIndexes: file_google_protobuf_go_features_proto_depIdxs, + MessageInfos: file_google_protobuf_go_features_proto_msgTypes, + ExtensionInfos: file_google_protobuf_go_features_proto_extTypes, }.Build() - File_reflect_protodesc_proto_go_features_proto = out.File - file_reflect_protodesc_proto_go_features_proto_rawDesc = nil - file_reflect_protodesc_proto_go_features_proto_goTypes = nil - file_reflect_protodesc_proto_go_features_proto_depIdxs = nil + File_google_protobuf_go_features_proto = out.File + file_google_protobuf_go_features_proto_rawDesc = nil + file_google_protobuf_go_features_proto_goTypes = nil + file_google_protobuf_go_features_proto_depIdxs = nil } diff --git a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto deleted file mode 100644 index d2465712..00000000 --- a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.proto +++ /dev/null @@ -1,28 +0,0 @@ -// Protocol Buffers - Google's data interchange format -// Copyright 2023 Google Inc. All rights reserved. -// -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file or at -// https://developers.google.com/open-source/licenses/bsd - -syntax = "proto2"; - -package google.protobuf; - -import "google/protobuf/descriptor.proto"; - -option go_package = "google.golang.org/protobuf/types/gofeaturespb"; - -extend google.protobuf.FeatureSet { - optional GoFeatures go = 1002; -} - -message GoFeatures { - // Whether or not to generate the deprecated UnmarshalJSON method for enums. - optional bool legacy_unmarshal_json_enum = 1 [ - retention = RETENTION_RUNTIME, - targets = TARGET_TYPE_ENUM, - edition_defaults = { edition: EDITION_PROTO2, value: "true" }, - edition_defaults = { edition: EDITION_PROTO3, value: "false" } - ]; -} diff --git a/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go b/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go index 9de51be5..7172b43d 100644 --- a/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go @@ -445,7 +445,7 @@ func file_google_protobuf_any_proto_rawDescGZIP() []byte { } var file_google_protobuf_any_proto_msgTypes = make([]protoimpl.MessageInfo, 1) -var file_google_protobuf_any_proto_goTypes = []interface{}{ +var file_google_protobuf_any_proto_goTypes = []any{ (*Any)(nil), // 0: google.protobuf.Any } var file_google_protobuf_any_proto_depIdxs = []int32{ @@ -462,7 +462,7 @@ func file_google_protobuf_any_proto_init() { return } if !protoimpl.UnsafeEnabled { - file_google_protobuf_any_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_any_proto_msgTypes[0].Exporter = func(v any, i int) any { switch v := v.(*Any); i { case 0: return &v.state diff --git a/vendor/google.golang.org/protobuf/types/known/durationpb/duration.pb.go b/vendor/google.golang.org/protobuf/types/known/durationpb/duration.pb.go index df709a8d..1b71bcd9 100644 --- a/vendor/google.golang.org/protobuf/types/known/durationpb/duration.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/durationpb/duration.pb.go @@ -323,7 +323,7 @@ func file_google_protobuf_duration_proto_rawDescGZIP() []byte { } var file_google_protobuf_duration_proto_msgTypes = make([]protoimpl.MessageInfo, 1) -var file_google_protobuf_duration_proto_goTypes = []interface{}{ +var file_google_protobuf_duration_proto_goTypes = []any{ (*Duration)(nil), // 0: google.protobuf.Duration } var file_google_protobuf_duration_proto_depIdxs = []int32{ @@ -340,7 +340,7 @@ func file_google_protobuf_duration_proto_init() { return } if !protoimpl.UnsafeEnabled { - file_google_protobuf_duration_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_duration_proto_msgTypes[0].Exporter = func(v any, i int) any { switch v := v.(*Duration); i { case 0: return &v.state diff --git a/vendor/google.golang.org/protobuf/types/known/emptypb/empty.pb.go b/vendor/google.golang.org/protobuf/types/known/emptypb/empty.pb.go index 9a7277ba..d87b4fb8 100644 --- a/vendor/google.golang.org/protobuf/types/known/emptypb/empty.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/emptypb/empty.pb.go @@ -115,7 +115,7 @@ func file_google_protobuf_empty_proto_rawDescGZIP() []byte { } var file_google_protobuf_empty_proto_msgTypes = make([]protoimpl.MessageInfo, 1) -var file_google_protobuf_empty_proto_goTypes = []interface{}{ +var file_google_protobuf_empty_proto_goTypes = []any{ (*Empty)(nil), // 0: google.protobuf.Empty } var file_google_protobuf_empty_proto_depIdxs = []int32{ @@ -132,7 +132,7 @@ func file_google_protobuf_empty_proto_init() { return } if !protoimpl.UnsafeEnabled { - file_google_protobuf_empty_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_empty_proto_msgTypes[0].Exporter = func(v any, i int) any { switch v := v.(*Empty); i { case 0: return &v.state diff --git a/vendor/google.golang.org/protobuf/types/known/structpb/struct.pb.go b/vendor/google.golang.org/protobuf/types/known/structpb/struct.pb.go index d2bac8b8..d45361cb 100644 --- a/vendor/google.golang.org/protobuf/types/known/structpb/struct.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/structpb/struct.pb.go @@ -49,11 +49,11 @@ // The standard Go "encoding/json" package has functionality to serialize // arbitrary types to a large degree. The Value.AsInterface, Struct.AsMap, and // ListValue.AsSlice methods can convert the protobuf message representation into -// a form represented by interface{}, map[string]interface{}, and []interface{}. +// a form represented by any, map[string]any, and []any. // This form can be used with other packages that operate on such data structures // and also directly with the standard json package. // -// In order to convert the interface{}, map[string]interface{}, and []interface{} +// In order to convert the any, map[string]any, and []any // forms back as Value, Struct, and ListValue messages, use the NewStruct, // NewList, and NewValue constructor functions. // @@ -88,28 +88,28 @@ // // To construct a Value message representing the above JSON object: // -// m, err := structpb.NewValue(map[string]interface{}{ +// m, err := structpb.NewValue(map[string]any{ // "firstName": "John", // "lastName": "Smith", // "isAlive": true, // "age": 27, -// "address": map[string]interface{}{ +// "address": map[string]any{ // "streetAddress": "21 2nd Street", // "city": "New York", // "state": "NY", // "postalCode": "10021-3100", // }, -// "phoneNumbers": []interface{}{ -// map[string]interface{}{ +// "phoneNumbers": []any{ +// map[string]any{ // "type": "home", // "number": "212 555-1234", // }, -// map[string]interface{}{ +// map[string]any{ // "type": "office", // "number": "646 555-4567", // }, // }, -// "children": []interface{}{}, +// "children": []any{}, // "spouse": nil, // }) // if err != nil { @@ -197,7 +197,7 @@ type Struct struct { // NewStruct constructs a Struct from a general-purpose Go map. // The map keys must be valid UTF-8. // The map values are converted using NewValue. -func NewStruct(v map[string]interface{}) (*Struct, error) { +func NewStruct(v map[string]any) (*Struct, error) { x := &Struct{Fields: make(map[string]*Value, len(v))} for k, v := range v { if !utf8.ValidString(k) { @@ -214,9 +214,9 @@ func NewStruct(v map[string]interface{}) (*Struct, error) { // AsMap converts x to a general-purpose Go map. // The map values are converted by calling Value.AsInterface. -func (x *Struct) AsMap() map[string]interface{} { +func (x *Struct) AsMap() map[string]any { f := x.GetFields() - vs := make(map[string]interface{}, len(f)) + vs := make(map[string]any, len(f)) for k, v := range f { vs[k] = v.AsInterface() } @@ -306,13 +306,13 @@ type Value struct { // ║ float32, float64 │ stored as NumberValue ║ // ║ string │ stored as StringValue; must be valid UTF-8 ║ // ║ []byte │ stored as StringValue; base64-encoded ║ -// ║ map[string]interface{} │ stored as StructValue ║ -// ║ []interface{} │ stored as ListValue ║ +// ║ map[string]any │ stored as StructValue ║ +// ║ []any │ stored as ListValue ║ // ╚════════════════════════╧════════════════════════════════════════════╝ // // When converting an int64 or uint64 to a NumberValue, numeric precision loss // is possible since they are stored as a float64. -func NewValue(v interface{}) (*Value, error) { +func NewValue(v any) (*Value, error) { switch v := v.(type) { case nil: return NewNullValue(), nil @@ -342,13 +342,13 @@ func NewValue(v interface{}) (*Value, error) { case []byte: s := base64.StdEncoding.EncodeToString(v) return NewStringValue(s), nil - case map[string]interface{}: + case map[string]any: v2, err := NewStruct(v) if err != nil { return nil, err } return NewStructValue(v2), nil - case []interface{}: + case []any: v2, err := NewList(v) if err != nil { return nil, err @@ -396,7 +396,7 @@ func NewListValue(v *ListValue) *Value { // // Floating-point values (i.e., "NaN", "Infinity", and "-Infinity") are // converted as strings to remain compatible with MarshalJSON. -func (x *Value) AsInterface() interface{} { +func (x *Value) AsInterface() any { switch v := x.GetKind().(type) { case *Value_NumberValue: if v != nil { @@ -580,7 +580,7 @@ type ListValue struct { // NewList constructs a ListValue from a general-purpose Go slice. // The slice elements are converted using NewValue. -func NewList(v []interface{}) (*ListValue, error) { +func NewList(v []any) (*ListValue, error) { x := &ListValue{Values: make([]*Value, len(v))} for i, v := range v { var err error @@ -594,9 +594,9 @@ func NewList(v []interface{}) (*ListValue, error) { // AsSlice converts x to a general-purpose Go slice. // The slice elements are converted by calling Value.AsInterface. -func (x *ListValue) AsSlice() []interface{} { +func (x *ListValue) AsSlice() []any { vals := x.GetValues() - vs := make([]interface{}, len(vals)) + vs := make([]any, len(vals)) for i, v := range vals { vs[i] = v.AsInterface() } @@ -716,7 +716,7 @@ func file_google_protobuf_struct_proto_rawDescGZIP() []byte { var file_google_protobuf_struct_proto_enumTypes = make([]protoimpl.EnumInfo, 1) var file_google_protobuf_struct_proto_msgTypes = make([]protoimpl.MessageInfo, 4) -var file_google_protobuf_struct_proto_goTypes = []interface{}{ +var file_google_protobuf_struct_proto_goTypes = []any{ (NullValue)(0), // 0: google.protobuf.NullValue (*Struct)(nil), // 1: google.protobuf.Struct (*Value)(nil), // 2: google.protobuf.Value @@ -743,7 +743,7 @@ func file_google_protobuf_struct_proto_init() { return } if !protoimpl.UnsafeEnabled { - file_google_protobuf_struct_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_struct_proto_msgTypes[0].Exporter = func(v any, i int) any { switch v := v.(*Struct); i { case 0: return &v.state @@ -755,7 +755,7 @@ func file_google_protobuf_struct_proto_init() { return nil } } - file_google_protobuf_struct_proto_msgTypes[1].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_struct_proto_msgTypes[1].Exporter = func(v any, i int) any { switch v := v.(*Value); i { case 0: return &v.state @@ -767,7 +767,7 @@ func file_google_protobuf_struct_proto_init() { return nil } } - file_google_protobuf_struct_proto_msgTypes[2].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_struct_proto_msgTypes[2].Exporter = func(v any, i int) any { switch v := v.(*ListValue); i { case 0: return &v.state @@ -780,7 +780,7 @@ func file_google_protobuf_struct_proto_init() { } } } - file_google_protobuf_struct_proto_msgTypes[1].OneofWrappers = []interface{}{ + file_google_protobuf_struct_proto_msgTypes[1].OneofWrappers = []any{ (*Value_NullValue)(nil), (*Value_NumberValue)(nil), (*Value_StringValue)(nil), diff --git a/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go b/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go index 81511a33..83a5a645 100644 --- a/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go @@ -332,7 +332,7 @@ func file_google_protobuf_timestamp_proto_rawDescGZIP() []byte { } var file_google_protobuf_timestamp_proto_msgTypes = make([]protoimpl.MessageInfo, 1) -var file_google_protobuf_timestamp_proto_goTypes = []interface{}{ +var file_google_protobuf_timestamp_proto_goTypes = []any{ (*Timestamp)(nil), // 0: google.protobuf.Timestamp } var file_google_protobuf_timestamp_proto_depIdxs = []int32{ @@ -349,7 +349,7 @@ func file_google_protobuf_timestamp_proto_init() { return } if !protoimpl.UnsafeEnabled { - file_google_protobuf_timestamp_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_timestamp_proto_msgTypes[0].Exporter = func(v any, i int) any { switch v := v.(*Timestamp); i { case 0: return &v.state diff --git a/vendor/google.golang.org/protobuf/types/known/wrapperspb/wrappers.pb.go b/vendor/google.golang.org/protobuf/types/known/wrapperspb/wrappers.pb.go index 762a8713..e473f826 100644 --- a/vendor/google.golang.org/protobuf/types/known/wrapperspb/wrappers.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/wrapperspb/wrappers.pb.go @@ -605,7 +605,7 @@ func file_google_protobuf_wrappers_proto_rawDescGZIP() []byte { } var file_google_protobuf_wrappers_proto_msgTypes = make([]protoimpl.MessageInfo, 9) -var file_google_protobuf_wrappers_proto_goTypes = []interface{}{ +var file_google_protobuf_wrappers_proto_goTypes = []any{ (*DoubleValue)(nil), // 0: google.protobuf.DoubleValue (*FloatValue)(nil), // 1: google.protobuf.FloatValue (*Int64Value)(nil), // 2: google.protobuf.Int64Value @@ -630,7 +630,7 @@ func file_google_protobuf_wrappers_proto_init() { return } if !protoimpl.UnsafeEnabled { - file_google_protobuf_wrappers_proto_msgTypes[0].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_wrappers_proto_msgTypes[0].Exporter = func(v any, i int) any { switch v := v.(*DoubleValue); i { case 0: return &v.state @@ -642,7 +642,7 @@ func file_google_protobuf_wrappers_proto_init() { return nil } } - file_google_protobuf_wrappers_proto_msgTypes[1].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_wrappers_proto_msgTypes[1].Exporter = func(v any, i int) any { switch v := v.(*FloatValue); i { case 0: return &v.state @@ -654,7 +654,7 @@ func file_google_protobuf_wrappers_proto_init() { return nil } } - file_google_protobuf_wrappers_proto_msgTypes[2].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_wrappers_proto_msgTypes[2].Exporter = func(v any, i int) any { switch v := v.(*Int64Value); i { case 0: return &v.state @@ -666,7 +666,7 @@ func file_google_protobuf_wrappers_proto_init() { return nil } } - file_google_protobuf_wrappers_proto_msgTypes[3].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_wrappers_proto_msgTypes[3].Exporter = func(v any, i int) any { switch v := v.(*UInt64Value); i { case 0: return &v.state @@ -678,7 +678,7 @@ func file_google_protobuf_wrappers_proto_init() { return nil } } - file_google_protobuf_wrappers_proto_msgTypes[4].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_wrappers_proto_msgTypes[4].Exporter = func(v any, i int) any { switch v := v.(*Int32Value); i { case 0: return &v.state @@ -690,7 +690,7 @@ func file_google_protobuf_wrappers_proto_init() { return nil } } - file_google_protobuf_wrappers_proto_msgTypes[5].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_wrappers_proto_msgTypes[5].Exporter = func(v any, i int) any { switch v := v.(*UInt32Value); i { case 0: return &v.state @@ -702,7 +702,7 @@ func file_google_protobuf_wrappers_proto_init() { return nil } } - file_google_protobuf_wrappers_proto_msgTypes[6].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_wrappers_proto_msgTypes[6].Exporter = func(v any, i int) any { switch v := v.(*BoolValue); i { case 0: return &v.state @@ -714,7 +714,7 @@ func file_google_protobuf_wrappers_proto_init() { return nil } } - file_google_protobuf_wrappers_proto_msgTypes[7].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_wrappers_proto_msgTypes[7].Exporter = func(v any, i int) any { switch v := v.(*StringValue); i { case 0: return &v.state @@ -726,7 +726,7 @@ func file_google_protobuf_wrappers_proto_init() { return nil } } - file_google_protobuf_wrappers_proto_msgTypes[8].Exporter = func(v interface{}, i int) interface{} { + file_google_protobuf_wrappers_proto_msgTypes[8].Exporter = func(v any, i int) any { switch v := v.(*BytesValue); i { case 0: return &v.state diff --git a/vendor/modules.txt b/vendor/modules.txt index ea2d49a2..861d6059 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -8,8 +8,8 @@ github.com/stoewer/go-strcase ## explicit; go 1.20 golang.org/x/exp/constraints golang.org/x/exp/slices -# golang.org/x/text v0.9.0 -## explicit; go 1.17 +# golang.org/x/text v0.16.0 +## explicit; go 1.18 golang.org/x/text/feature/plural golang.org/x/text/internal golang.org/x/text/internal/catmsg @@ -22,14 +22,14 @@ golang.org/x/text/internal/tag golang.org/x/text/language golang.org/x/text/message golang.org/x/text/message/catalog -# google.golang.org/genproto/googleapis/api v0.0.0-20230803162519-f966b187b2e5 -## explicit; go 1.19 +# google.golang.org/genproto/googleapis/api v0.0.0-20240826202546-f6391c0de4c7 +## explicit; go 1.21 google.golang.org/genproto/googleapis/api/expr/v1alpha1 -# google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5 -## explicit; go 1.19 +# google.golang.org/genproto/googleapis/rpc v0.0.0-20240823204242-4ba0660f739c +## explicit; go 1.21 google.golang.org/genproto/googleapis/rpc/status -# google.golang.org/protobuf v1.33.0 -## explicit; go 1.17 +# google.golang.org/protobuf v1.34.2 +## explicit; go 1.20 google.golang.org/protobuf/encoding/protojson google.golang.org/protobuf/encoding/prototext google.golang.org/protobuf/encoding/protowire @@ -37,6 +37,7 @@ google.golang.org/protobuf/internal/descfmt google.golang.org/protobuf/internal/descopts google.golang.org/protobuf/internal/detrand google.golang.org/protobuf/internal/editiondefaults +google.golang.org/protobuf/internal/editionssupport google.golang.org/protobuf/internal/encoding/defval google.golang.org/protobuf/internal/encoding/json google.golang.org/protobuf/internal/encoding/messageset