From ae260a66719b8c09807c2729e05f43ab5442fd42 Mon Sep 17 00:00:00 2001
From: Rasko Leinonen <rasko@ebi.ac.uk>
Date: Wed, 15 Aug 2018 13:25:05 +0100
Subject: [PATCH 1/2] Add 206, 303, 501 return codes for /sequence/{id}.

---
 pub/refget-openapi.yaml | 6 ++++++
 1 file changed, 6 insertions(+)

diff --git a/pub/refget-openapi.yaml b/pub/refget-openapi.yaml
index 0b8c12450..a82cdaa79 100644
--- a/pub/refget-openapi.yaml
+++ b/pub/refget-openapi.yaml
@@ -106,6 +106,12 @@ paths:
           $ref: '#/components/responses/BadFormat'
         '416':
           description: Invalid range request specified
+        '206':
+          description: Successful retrieval of subsequence as a single string with no line breaks
+        '303':
+          description: Redirecting the client where the sequence can be retrieved
+        '501': 
+          description: The specified request is not supported by the server          
   '/sequence/{id}/metadata':
     get:
       summary: Get reference metadata from a hash

From 758f43ef6917a3404dc8d47acf872bca8db7eeb4 Mon Sep 17 00:00:00 2001
From: rasko <rasko@ebi.ac.uk>
Date: Wed, 15 Aug 2018 17:25:51 +0100
Subject: [PATCH 2/2] Added 302 and 307 return codes to /sequence/{id} and
 ordered /sequence/{id} return codes in numerical order.

---
 pub/refget-openapi.yaml | 14 +++++++++-----
 1 file changed, 9 insertions(+), 5 deletions(-)

diff --git a/pub/refget-openapi.yaml b/pub/refget-openapi.yaml
index a82cdaa79..628e4093c 100644
--- a/pub/refget-openapi.yaml
+++ b/pub/refget-openapi.yaml
@@ -98,6 +98,14 @@ paths:
                 type: string
                 example: >-
                   MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISKVAGKLF
+        '206':
+          description: Successful retrieval of subsequence as a single string with no line breaks
+        '302':
+          description: Redirecting the client where the sequence can be retrieved
+        '303':
+          description: Redirecting the client where the sequence can be retrieved
+        '307':
+          description: Redirecting the client where the sequence can be retrieved
         '400':
           description: Invalid input; normally due to range parameter usage
         '404':
@@ -106,11 +114,7 @@ paths:
           $ref: '#/components/responses/BadFormat'
         '416':
           description: Invalid range request specified
-        '206':
-          description: Successful retrieval of subsequence as a single string with no line breaks
-        '303':
-          description: Redirecting the client where the sequence can be retrieved
-        '501': 
+        '501':
           description: The specified request is not supported by the server          
   '/sequence/{id}/metadata':
     get: