-
Notifications
You must be signed in to change notification settings - Fork 63
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Merge remote-tracking branch 'origin/hotfix'
- Loading branch information
Showing
11 changed files
with
65 additions
and
28 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
|
@@ -61,7 +61,7 @@ | |
|
||
setup( | ||
name="pvactools", | ||
version="1.5.3", | ||
version="1.5.4", | ||
packages=[ | ||
"tools", | ||
"tools.pvacbind", | ||
|
8 changes: 8 additions & 0 deletions
8
...test_data/output_parser/input_frameshift_variant_position_1.MHCnuggetsI.HLA-A*02:01.8.tsv
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,8 @@ | ||
peptide ic50 seq_num start allele | ||
PRPKRLST 32090.567698455194 2 2 HLA-A*02:01 | ||
RPRPKRLS 32488.54503574128 2 1 HLA-A*02:01 | ||
AAAPEAPV 10669.99440612248 1 1 HLA-A*02:01 | ||
RPKRLSTR 31020.901282749608 2 3 HLA-A*02:01 | ||
APEAPVYA 17866.570741869527 1 3 HLA-A*02:01 | ||
PKRLSTRT 31935.534444637513 2 4 HLA-A*02:01 | ||
AAPEAPVY 30318.795326400505 1 2 HLA-A*02:01 |
4 changes: 4 additions & 0 deletions
4
tests/test_data/output_parser/input_frameshift_variant_position_1.key
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,4 @@ | ||
1: | ||
- WT.1.JUND.ENST00000600972.FS.1GC/G | ||
2: | ||
- MT.1.JUND.ENST00000600972.FS.1GC/G |
2 changes: 2 additions & 0 deletions
2
tests/test_data/output_parser/input_frameshift_variant_position_1.tsv
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,2 @@ | ||
chromosome_name start stop reference variant gene_name transcript_name transcript_support_level amino_acid_change codon_change ensembl_gene_id hgvsc hgvsp wildtype_amino_acid_sequence downstream_amino_acid_sequence fusion_amino_acid_sequence variant_type protein_position transcript_expression gene_expression normal_depth normal_vaf tdna_depth tdna_vaf trna_depth trna_vaf index protein_length_change | ||
19 18280928 18280929 GC G JUND ENST00000600972 2 A/X Gcg/cg ENSG00000130522 ENST00000600972.1:c.1del ENSP00000475153.2:p.Ala1ArgfsTer? AAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQREEQSVRF RPRPKRLSTRT FS 1 NA NA NA NA 4 1.0 NA NA 1.JUND.ENST00000600972.FS.1GC/G -154 |
5 changes: 5 additions & 0 deletions
5
tests/test_data/output_parser/output_frameshift_variant_position_1.iedb.parsed.tsv
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,5 @@ | ||
Chromosome Start Stop Reference Variant Transcript Transcript Support Level Ensembl Gene ID Variant Type Mutation Protein Position Gene Name HGVSc HGVSp HLA Allele Peptide Length Sub-peptide Position Mutation Position MT Epitope Seq WT Epitope Seq Best MT Score Method Best MT Score Corresponding WT Score Corresponding Fold Change Tumor DNA Depth Tumor DNA VAF Tumor RNA Depth Tumor RNA VAF Normal Depth Normal VAF Gene Expression Transcript Expression Median MT Score Median WT Score Median Fold Change MHCnuggetsI WT Score MHCnuggetsI MT Score | ||
19 18280928 18280929 GC G ENST00000600972 2 ENSG00000130522 FS A/X 1 JUND ENST00000600972.1:c.1del ENSP00000475153.2:p.Ala1ArgfsTer? HLA-A*02:01 8 4 0 PKRLSTRT NA MHCnuggetsI 31935.534 NA NA 4 1.0 NA NA NA NA NA NA 31935.534 NA NA NA 31935.534444637513 | ||
19 18280928 18280929 GC G ENST00000600972 2 ENSG00000130522 FS A/X 1 JUND ENST00000600972.1:c.1del ENSP00000475153.2:p.Ala1ArgfsTer? HLA-A*02:01 8 1 1 RPRPKRLS NA MHCnuggetsI 32488.545 NA NA 4 1.0 NA NA NA NA NA NA 32488.545 NA NA NA 32488.54503574128 | ||
19 18280928 18280929 GC G ENST00000600972 2 ENSG00000130522 FS A/X 1 JUND ENST00000600972.1:c.1del ENSP00000475153.2:p.Ala1ArgfsTer? HLA-A*02:01 8 3 0 RPKRLSTR NA MHCnuggetsI 31020.901 NA NA 4 1.0 NA NA NA NA NA NA 31020.901 NA NA NA 31020.901282749608 | ||
19 18280928 18280929 GC G ENST00000600972 2 ENSG00000130522 FS A/X 1 JUND ENST00000600972.1:c.1del ENSP00000475153.2:p.Ala1ArgfsTer? HLA-A*02:01 8 2 0 PRPKRLST NA MHCnuggetsI 32090.568 NA NA 4 1.0 NA NA NA NA NA NA 32090.568 NA NA NA 32090.567698455194 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters