Skip to content
New issue

Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.

By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.

Already on GitHub? Sign in to your account

Add 206, 303, 501 return codes for /sequence/{id} in refget-openapi.yaml.. #330

Merged
merged 2 commits into from
Aug 15, 2018
Merged
Changes from all commits
Commits
File filter

Filter by extension

Filter by extension

Conversations
Failed to load comments.
Loading
Jump to
Jump to file
Failed to load files.
Loading
Diff view
Diff view
10 changes: 10 additions & 0 deletions pub/refget-openapi.yaml
Original file line number Diff line number Diff line change
Expand Up @@ -98,6 +98,14 @@ paths:
type: string
example: >-
MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISKVAGKLF
'206':
description: Successful retrieval of subsequence as a single string with no line breaks
'302':
description: Redirecting the client where the sequence can be retrieved
'303':
description: Redirecting the client where the sequence can be retrieved
'307':
description: Redirecting the client where the sequence can be retrieved
'400':
description: Invalid input; normally due to range parameter usage
'404':
Expand All @@ -106,6 +114,8 @@ paths:
$ref: '#/components/responses/BadFormat'
'416':
description: Invalid range request specified
'501':
description: The specified request is not supported by the server
'/sequence/{id}/metadata':
get:
summary: Get reference metadata from a hash
Expand Down